SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014569 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014569
Domain Number 1 Region: 132-244
Classification Level Classification E-value
Superfamily PH domain-like 1.28e-33
Family Phosphotyrosine-binding domain (PTB) 0.00000572
Further Details:      
 
Domain Number 2 Region: 7-110
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-18
Family Phosphotyrosine-binding domain (PTB) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014569   Gene: ENSPANG00000021794   Transcript: ENSPANT00000023806
Sequence length 306
Comment pep:known_by_projection chromosome:PapAnu2.0:10:9588374:9759369:-1 gene:ENSPANG00000021794 transcript:ENSPANT00000023806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNFNDIVKQGYVRIRSRRLGIYQRCWLVFKKASSKGPKRLEKFSDERAAYFRCYHKVT
ELNNVKNVARLPKSTKKHAIGIYFNDDTSKTFACESDLEADEWCKVLQMECVGTRINDIS
LGEPDLLATGVEREQSERFNVYLMPSPNLDVHGECALQITYEYICLWDVQNPRVKLISWP
LSALRRYGRDTTWFTFEAGRMCETGEGLFIFQTRDGEAIYQKVHSAALAIAEQHERLLQS
VKNSMLQMKMSERAASLSTMVPLPRSAYWQHITRQHSTGQLYRLQDVASPLKLHRTETFP
AYRSEH
Download sequence
Identical sequences A0A096NNK9 A0A2K5C028 A0A2K5LA12 A0A2K5Z1L6 F7BN10
ENSPANP00000014569 ENSCJAP00000004727 ENSCJAP00000004732 XP_002747737.1.60252 XP_011833520.1.47321 XP_011914355.1.92194 XP_012322912.1.9421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]