SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014595 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014595
Domain Number 1 Region: 4-131
Classification Level Classification E-value
Superfamily EF-hand 1.89e-44
Family p25-alpha 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014595   Gene: ENSPANG00000020506   Transcript: ENSPANT00000015660
Sequence length 172
Comment pep:known_by_projection chromosome:PapAnu2.0:7:77654820:77656390:1 gene:ENSPANG00000020506 transcript:ENSPANT00000015660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEAEKTFNRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNA
RTITFQQFKEAVKELGQKRFKGKSPDEVLESIYGLMEGKDPATTGATKATTVGAVDRLTD
TSKYTGTHKERFDESGKGKGIAGREVMNDNTGYVSGYKGAGTYDKKTKELGK
Download sequence
Identical sequences ENSPANP00000014595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]