SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014609 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014609
Domain Number 1 Region: 3-294
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.17e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014609   Gene: ENSPANG00000011165   Transcript: ENSPANT00000008112
Sequence length 435
Comment pep:known_by_projection chromosome:PapAnu2.0:10:13588814:13660481:-1 gene:ENSPANG00000011165 transcript:ENSPANT00000008112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE
PPPEHVPPPPRPPKRILEPHNGKCREFFPNHQWVKDETQEDKDCPIKEEAGSPLNAAPYS
MESMSQDTEVRSRVVGGSLRGAQAASLAKGEPSPPKKEEDHALSHWKPFLVNMCVATVLT
AGAYLCYRFLFNSNT
Download sequence
Identical sequences A0A096NNP9
ENSPANP00000014609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]