SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014612 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014612
Domain Number 1 Region: 621-759
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.39e-42
Family PLC-like (P variant) 0.0000328
Further Details:      
 
Domain Number 2 Region: 792-930
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.28e-38
Family PLC-like (P variant) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014612   Gene: ENSPANG00000021790   Transcript: ENSPANT00000025670
Sequence length 1289
Comment pep:known_by_projection chromosome:PapAnu2.0:7:77907004:77976951:1 gene:ENSPANG00000021790 transcript:ENSPANT00000025670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHLGDPTSEDLPVRDTDAIPLVLPASKGKNMKTQPHLSRMNREELEDSFFRLREDHMLV
KELSWKQQDEIKRLRTTLLRLTAAGRDLRVAEAAAPLSETTRRGQNAGWRQRLSMHQRPQ
IHRLQGQLHRLGSAGPRRAQPRVHVGHRQLHTAGAPVSEKPKRGPRDRLSYTAPPSFKEH
ATNENGGEIASERSELISGSNSIISFSNVVSMAKPIGLCMPNSAHTMASNTMQVEEPPKS
PEKMWPKDENFEQRSSLECAQKAAELRASIKEKVELIRLKKLLHERNASLVMTKAQLTEV
QEAYETLLQKNQGILSAAHEALLNQVNELRAELKEESKKAMSLKSQLEDVSILQMTLKEI
SCEIKDSKVPRQLVNDSLGYPSESLLSVVSMLDSSSQPHWSNELIAEQLQQQVSQLQDQL
DAELEEKRKVLLDLSREKAQNEDLKLEVTNILQKHKQEVELLQKAATISQPPDSQSEAAT
HPAVFQENTQIQPSEPNNQEEKKLSQVLNELQVSHAETTLELEKTRDMLILQRKINVCYQ
EELEAMMTKAANDNRDHKEKLERLTRLLDLKNNRIKQLEGILRSHDLPTSEQLKDVAYGT
RQLSLCLETLPAHGDEDKVDISLLHQGENLFELHIHQAFLTSAALAQAGDTQPTTFCTYS
FYDFETHCTPLSVGPQPLYDFTSQYVMETDSLFLHYLQEASARLDLHQAVASEHNTLAAG
WICFDRVLETVEKVHGLATLIGAGGEEFGVLEYWMRLRFPIKPSLQACNKRKKAQVYLST
NVLGGRKAQEDEFRLESWEPQNELQIEITKCCGLRSRWLGTQPSPYAVYRFFTFSDHDTA
IIPASDNPYFRDQARFPVLVTSDLDQYLRREALSIHVFDDEDLEPGSYLGRAQVPLLPLA
KNESIKGDFNLTDPAEKPNGSIQVQLDWKFPYIPPESFLKPEAQTKGKDTKDSSKISSEE
EKASFPSQDQMVPPGVPVEAGQYQARRKSPHGGERKEKEHQVVSYSRRKHGKRIGVQGKN
RMEYLSLNVLNGNTPEQVNYTEWKFSEAYSSIGDGFKNEPEEEEMTLSHSALKQKEPLHP
VNADKESSEQGSEVSEAQTTDSDDVIVPPMSRKYKADSEKMCIEIVSLAFYPEAEVMSDE
NIKQVYVEYKFYNLPLSETETPVSLRKPRAGEEIYFHFSKVIDLDPQEQQDRRQFLFDML
TGQDPDQGHLKFTVVSDPLDEEKKECEEVGYAYLKLWQILESGRDILEQELDIVSPEDLA
TPIGRLKVSLQAAAVLHAIYKEMTEDLFS
Download sequence
Identical sequences ENSPANP00000014612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]