SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014617 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000014617
Domain Number - Region: 69-151
Classification Level Classification E-value
Superfamily PUG domain-like 0.00248
Family PUG domain 0.016
Further Details:      
 
Domain Number - Region: 452-501
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0115
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014617   Gene: ENSPANG00000020781   Transcript: ENSPANT00000016399
Sequence length 520
Comment pep:known_by_projection chromosome:PapAnu2.0:10:14272982:14275911:1 gene:ENSPANG00000020781 transcript:ENSPANT00000016399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKPSSMDTKFKDDLFRKYVQFHEGKVDTTTSRQRPGGDECLRVAASTLLSLHKVDPFYR
FRLIQFYEVVESSLRSLSSSSLRALHGAFSMLETVGINLFLYPWKKEFRSIKTYTGPFVY
YVKSTLLEEDIRAILSCMGYAPELGTAYKLRELVETLQVKMVSFELFLAKVECEQMLEIH
SQVKDKGYSELDIVSERKSSAEDVRGCSDALRRRAEGREHLTASMSRVALQKSASERAAK
DYYKPRVTKPSRSVDAYDSYWESRKPPLKASLSLRKEPVAADVGDDLKDEIIRPSPSLLT
MASSPHGSPDALPPASPSNGPGLLRGTYFSTQDDVDLYTDSEPRATYRRQDALRPDVWLV
RNDAHPLYHKRSPPAKESALSKCQSCGLSCSSSLCQRCDSLLTCPPASKPSVFPSKASTH
DSLAHGASLREKYPGQTQGLDRLPHLHSKSKPSSTPTSRCGFCNRPGATNTCTQCSKVSC
DACLSAYHYDPCYKKSELHKFMPNKQLNYKSTQLSHLVYR
Download sequence
Identical sequences A0A096NNQ7 A0A2K5ZP42
XP_011848579.1.47321 XP_011848581.1.47321 ENSPANP00000014617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]