SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014674 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014674
Domain Number 1 Region: 412-536
Classification Level Classification E-value
Superfamily TIMP-like 3.3e-36
Family Netrin-like domain (NTR/C345C module) 0.000000363
Further Details:      
 
Domain Number 2 Region: 253-366
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-35
Family Spermadhesin, CUB domain 0.00013
Further Details:      
 
Domain Number 3 Region: 106-216
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-34
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014674   Gene: ENSPANG00000018315   Transcript: ENSPANT00000021937
Sequence length 545
Comment pep:known_by_projection scaffold:PapAnu2.0:JH684952.1:93495:100461:-1 gene:ENSPANG00000018315 transcript:ENSPANT00000021937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPRPREVPGHATVPPSPPPAPLASPHAHTPEAAPSGADYPAAAATAAAALQNSAAASVL
RTSASFPRAMLPAATASLLGPLLTAWALLPFAQGQTPNYTRPVFLCGGDVKGESGYVASE
GFPNLYPPNKECIWTITVPEGQTVSLSFRVFDLELHPACRYDALEVFAGSGTSGQRLGRF
CGTFRPAPLVAPGNQVTLRMTADEGTGGRGFLLWYSGRATSGTGPPPGARRKWVTDPRVE
WAAWGYWDEHQFCGGRLEKAQGTLTTPNWPESDYPPGISCSWHIIAPRDQVIALTFEKFD
LEPDTYCRYDSVSVFNGAVSDDSRRLGKFCGDAVPGSISSEGNELLVQFVSDLSVTADGF
SASYKTLPRGTAKEGQGPSPKPGTEPKVKPPRKSQPPEKTEETPSAPDAPAVTCPKQCRR
TGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPSPPTGTSLKFYV
PCKQCPPLKKGVSYLLMGQVEENRGPVLPPESFVVLHRPNQDQILTNLSKRKCPSQPVRA
AESQD
Download sequence
Identical sequences ENSPANP00000014674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]