SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014719 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014719
Domain Number 1 Region: 6-101
Classification Level Classification E-value
Superfamily PH domain-like 6.77e-18
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.068
Further Details:      
 
Domain Number 2 Region: 175-404,506-633
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000576
Family Armadillo repeat 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014719   Gene: ENSPANG00000022844   Transcript: ENSPANT00000026742
Sequence length 817
Comment pep:known_by_projection chromosome:PapAnu2.0:13:54715940:54786556:-1 gene:ENSPANG00000022844 transcript:ENSPANT00000026742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTRRRVKVYTLNEDRQWDDRGTGHVSSTYVEELKGMSLLVRAESDGSLLLESKINPNT
AYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVEVTQDLIDESEEE
RFEEMPETSHLIDLPTCELNKLEEIADLVTSVLSSPIRREKLALALENEGYIKKLLQLFQ
ACENLENTEGLHHLYEIIRGILFLNKATLFEVMFSDECIMDVVGCLEYDPALAQPKRHRE
FLTKTAKFKEVIPITDSELRQKIHQTYRVQYIQDIILPTPSVFEENFLSTLTSFIFFNKV
EIVSMLQEDEKFLSEVFAQLTDEATDDDKRRELVNFFKEFCAFSQTLQPQNRDAFFKTLA
KLGILPALEIVMGMDDLQVRSAATDIFSYLVEFSPSMVREFVMQEAQQSDDDILLINVVI
EQMICDTDPELGGAVQLMGLLRTLIDPENMLATTNKTEKSEFLNFFYNHCMHVLTAPLLT
NTSEDKCEKDNIVGSNKNNTICPDNYQTAQLLALILELLTFCVEHHTYHIKNYIMNKDLL
RRVLVLMNSKHTFLALCALRFMRRIIGLKDEFYNRYITKGNLFEPVINALLDNGTRYNLL
NSAVIELFEFIRVEDIKSLTAHIVENFYKALESIEYVQTFKGLKTKYEQEKDRQNQKLNS
VPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKVVVAPAEKSKPEDDFPDNYEKFMETK
KAKESEDKENLPKRTSPGGFKFTFSHSASAANGTNSKSVVAQTPPATSNGSSSKTTNLAT
SVTATKGSLVGLVDYPDDEEEDEEEETSPRKRPRLGS
Download sequence
Identical sequences ENSPANP00000014719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]