SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014767 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014767
Domain Number 1 Region: 59-166
Classification Level Classification E-value
Superfamily TPR-like 8.07e-21
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014767   Gene: ENSPANG00000008956   Transcript: ENSPANT00000017134
Sequence length 262
Comment pep:known_by_projection chromosome:PapAnu2.0:6:40171927:40202021:-1 gene:ENSPANG00000008956 transcript:ENSPANT00000017134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFGWKRKIGEKVSKVTSQQFEAEAADEKDVVDNDEGNWLHAIKRRKEILLEGCAEKSK
QLKDEGASLAENKRYREAIQKWDEALQLTPNDATLYEMKSQVLMSLHEMFPAVHAAEMAV
QRNPHSWESWQTLGRAQLGLGEIILAIRSFQVALHIYPMNPEIWKEDLSWARTLQEQQKV
AQRIKKSEAPAEVTHFSPKSIPDYDFESDEIVAVCAAIAEKEKTVSSNKTMVIVSASGAV
ETVTEKEDGATPPDGSVFIKAR
Download sequence
Identical sequences A0A096NP50
ENSPANP00000014767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]