SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014783 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014783
Domain Number 1 Region: 4831-5046
Classification Level Classification E-value
Superfamily GFP-like 1.78e-62
Family Domain G2 of nidogen-1 0.0008
Further Details:      
 
Domain Number 2 Region: 2429-2525
Classification Level Classification E-value
Superfamily Immunoglobulin 2.99e-25
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 3585-3677
Classification Level Classification E-value
Superfamily Immunoglobulin 1.32e-24
Family I set domains 0.0076
Further Details:      
 
Domain Number 4 Region: 1115-1212
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-23
Family I set domains 0.0091
Further Details:      
 
Domain Number 5 Region: 2535-2622
Classification Level Classification E-value
Superfamily Immunoglobulin 1.17e-23
Family I set domains 0.0086
Further Details:      
 
Domain Number 6 Region: 3004-3105
Classification Level Classification E-value
Superfamily Immunoglobulin 1.53e-23
Family I set domains 0.0072
Further Details:      
 
Domain Number 7 Region: 3195-3292
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-23
Family I set domains 0.0045
Further Details:      
 
Domain Number 8 Region: 4033-4130
Classification Level Classification E-value
Superfamily Immunoglobulin 2.94e-23
Family I set domains 0.015
Further Details:      
 
Domain Number 9 Region: 2633-2721
Classification Level Classification E-value
Superfamily Immunoglobulin 5.44e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 10 Region: 3945-4041
Classification Level Classification E-value
Superfamily Immunoglobulin 6.59e-23
Family I set domains 0.033
Further Details:      
 
Domain Number 11 Region: 2345-2431
Classification Level Classification E-value
Superfamily Immunoglobulin 6.65e-23
Family I set domains 0.016
Further Details:      
 
Domain Number 12 Region: 2913-3011
Classification Level Classification E-value
Superfamily Immunoglobulin 7.8e-23
Family I set domains 0.0044
Further Details:      
 
Domain Number 13 Region: 1772-1871
Classification Level Classification E-value
Superfamily Immunoglobulin 1.41e-22
Family I set domains 0.0079
Further Details:      
 
Domain Number 14 Region: 2238-2339
Classification Level Classification E-value
Superfamily Immunoglobulin 2.35e-22
Family I set domains 0.015
Further Details:      
 
Domain Number 15 Region: 3666-3764
Classification Level Classification E-value
Superfamily Immunoglobulin 4.21e-22
Family I set domains 0.016
Further Details:      
 
Domain Number 16 Region: 4304-4401
Classification Level Classification E-value
Superfamily Immunoglobulin 4.74e-22
Family I set domains 0.0079
Further Details:      
 
Domain Number 17 Region: 2741-2824
Classification Level Classification E-value
Superfamily Immunoglobulin 6.63e-22
Family I set domains 0.022
Further Details:      
 
Domain Number 18 Region: 3850-3949
Classification Level Classification E-value
Superfamily Immunoglobulin 6.75e-22
Family I set domains 0.026
Further Details:      
 
Domain Number 19 Region: 553-651
Classification Level Classification E-value
Superfamily Immunoglobulin 6.98e-22
Family I set domains 0.02
Further Details:      
 
Domain Number 20 Region: 1037-1128
Classification Level Classification E-value
Superfamily Immunoglobulin 8.95e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 21 Region: 1696-1779
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-21
Family I set domains 0.02
Further Details:      
 
Domain Number 22 Region: 2832-2920
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-21
Family I set domains 0.0061
Further Details:      
 
Domain Number 23 Region: 1398-1499
Classification Level Classification E-value
Superfamily Immunoglobulin 2.12e-21
Family I set domains 0.029
Further Details:      
 
Domain Number 24 Region: 1317-1406
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-21
Family I set domains 0.017
Further Details:      
 
Domain Number 25 Region: 737-836
Classification Level Classification E-value
Superfamily Immunoglobulin 2.41e-21
Family I set domains 0.019
Further Details:      
 
Domain Number 26 Region: 4123-4221
Classification Level Classification E-value
Superfamily Immunoglobulin 2.86e-21
Family I set domains 0.018
Further Details:      
 
Domain Number 27 Region: 840-934
Classification Level Classification E-value
Superfamily Immunoglobulin 5.36e-21
Family I set domains 0.0089
Further Details:      
 
Domain Number 28 Region: 1493-1592
Classification Level Classification E-value
Superfamily Immunoglobulin 5.71e-21
Family I set domains 0.0043
Further Details:      
 
Domain Number 29 Region: 3758-3857
Classification Level Classification E-value
Superfamily Immunoglobulin 6.03e-21
Family I set domains 0.0058
Further Details:      
 
Domain Number 30 Region: 4209-4307
Classification Level Classification E-value
Superfamily Immunoglobulin 8.5e-21
Family I set domains 0.017
Further Details:      
 
Domain Number 31 Region: 1959-2058
Classification Level Classification E-value
Superfamily Immunoglobulin 1.33e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 32 Region: 3103-3200
Classification Level Classification E-value
Superfamily Immunoglobulin 2.13e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 33 Region: 2053-2147
Classification Level Classification E-value
Superfamily Immunoglobulin 3.49e-20
Family I set domains 0.0051
Further Details:      
 
Domain Number 34 Region: 468-567
Classification Level Classification E-value
Superfamily Immunoglobulin 3.51e-20
Family I set domains 0.056
Further Details:      
 
Domain Number 35 Region: 4392-4486
Classification Level Classification E-value
Superfamily Immunoglobulin 5.96e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 36 Region: 1869-1965
Classification Level Classification E-value
Superfamily Immunoglobulin 7.43e-20
Family I set domains 0.02
Further Details:      
 
Domain Number 37 Region: 3399-3485
Classification Level Classification E-value
Superfamily Immunoglobulin 1.06e-19
Family I set domains 0.0086
Further Details:      
 
Domain Number 38 Region: 3308-3391
Classification Level Classification E-value
Superfamily Immunoglobulin 2.41e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 39 Region: 3473-3575
Classification Level Classification E-value
Superfamily Immunoglobulin 3.51e-19
Family I set domains 0.019
Further Details:      
 
Domain Number 40 Region: 1600-1686
Classification Level Classification E-value
Superfamily Immunoglobulin 4.58e-19
Family I set domains 0.0075
Further Details:      
 
Domain Number 41 Region: 1228-1312
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-18
Family I set domains 0.0033
Further Details:      
 
Domain Number 42 Region: 2144-2244
Classification Level Classification E-value
Superfamily Immunoglobulin 3.27e-18
Family I set domains 0.0084
Further Details:      
 
Domain Number 43 Region: 652-750
Classification Level Classification E-value
Superfamily Immunoglobulin 1.34e-17
Family I set domains 0.023
Further Details:      
 
Domain Number 44 Region: 932-1025
Classification Level Classification E-value
Superfamily Immunoglobulin 2.87e-17
Family I set domains 0.0082
Further Details:      
 
Domain Number 45 Region: 5052-5195
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.08e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 46 Region: 1-166
Classification Level Classification E-value
Superfamily vWA-like 6.23e-16
Family Integrin A (or I) domain 0.029
Further Details:      
 
Domain Number 47 Region: 4541-4599
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000122
Family TSP-1 type 1 repeat 0.00028
Further Details:      
 
Domain Number 48 Region: 4598-4656
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000523
Family TSP-1 type 1 repeat 0.00019
Further Details:      
 
Domain Number 49 Region: 4486-4542
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000109
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 50 Region: 4770-4827
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000157
Family TSP-1 type 1 repeat 0.00025
Further Details:      
 
Domain Number 51 Region: 4656-4713
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000327
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 52 Region: 4712-4770
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000235
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 53 Region: 5283-5322,5402-5494
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000455
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 54 Region: 395-472
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000977
Family I set domains 0.048
Further Details:      
 
Domain Number 55 Region: 5226-5275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000352
Family EGF-type module 0.018
Further Details:      
 
Domain Number 56 Region: 5185-5228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000244
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014783   Gene: ENSPANG00000001047   Transcript: ENSPANT00000004946
Sequence length 5602
Comment pep:known_by_projection chromosome:PapAnu2.0:1:178142520:178589064:-1 gene:ENSPANG00000001047 transcript:ENSPANT00000004946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYDDLVQVIEGASKILETSLKRPKRPLFNFALVPFHDPEIGPVTITTDPKKFQYELRELY
VQGGGDCPEMSIGAIKIALEISLPGSFIYVFTDARSKDYRLTHEVLQLIQQKQSQVVFVL
TGDCDDRTHIGYKVYEEIASTSSGQVFHLDKKQVNEVLKWVEEAVQASKVHLLSTDHLEQ
AVNTWRIPFDPSLKEVTVSLSGPSPVIEVRNPLGKLIKKGFGLNELLNIHNSAKVVNVKE
PEAGMWTVKTSSSGRHSVRITGLSTIDFRAGFSRKPTLDFKKTVSRPVQGIPTYVLLNTS
GISAPARIDLLELLSISGSSLKTIPVKYYPDRKPYGIWNISDFVPPNEAFFLKVTGYDED
DYLFQRVSSVSFSSIVPVDAPKVTMPEKTPGYYLQPGQIPCSVDSLLPFTLSFVRNGVTL
GVDQYLKESASVNLDIEKVTLSDEGFYECIAVSSTGVHFLQTRFEITEPPPVIQVPSNVT
VTPGETAVLTCLIISAVDYNLTWQRNDRDVRLAEPARIRTLTNLSLELKSVKFNDAGEYL
CMVSSEGGSSAASVFLTVQEPPKVTVMPKNQSFTGGSEVSIMCSATGYPKPKIAWTANDM
FIVGSHSRYRMTSDGTLFIKNAAPKDAGIYGCLASNSAGTDKQSSTLRYVEAPKLIVVQS
ELLVALGDITVMECKTSGIPPPQVKWFKGDLELRPSTFLIIDPLLGLLKIQETQDLDAGD
YTCVAINEAGRATGKITLDVGSPPVFIQEPADVSMEIGSNVTLPCYVQGYPEPTIKWRRL
DNMPIFSRPFSVSSISQLRTGALFILNLWASDKGTYICEAENQFGKIQSDTTITVTGLVA
PLIGISPSVANVIEGQQLTLPCTLLAGNPIPERRWIKNSAMLLQNPYITVRSDGSLHIER
VQLHDGGEYTCVASNVAGTNNKTTSVVVHVLPTIQHGQQILSTIEGIPVTLPCKASGIPK
PSVIWSKKGELISTSSAKFSAGADGSLYVVSPGGEESGEYVCTATNAAGYAKRKVQLTVY
VRPRVFGDQRGLSQDKPVEISVLAGEEVTLPCEVKSLPPPIITWAKETQLISPFSPRHTF
LPSGSMKITETRISDSGMYLCVATNIAGNVTQAVKLNVHVPPKIQRGPKHLKVQVGQRVD
IPCNAQGTPLPVITWSKGGSTMLVDGVQHVSNPDGTLSIDQAMPSDAGIYTCVATNIAGT
DETEITLHVQEPPTVEDLEPPYNTPFQERVANQRIAFPCPAKGTPKPTIKWLHNGRELTG
REPGISVLEDGTLLVIASVTPYNNGEYICVAVNEAGTTERKYNLKVHVPPVIKDKEQVTN
VSVLLNQLTNLFCEVEGTPSPIIMWYKDNVQVTESSTVQIVNNGKILKFFKATPEDAGRY
SCKAINIAGTSQKYFNIDVLVPPTIIGTNFPNEVSVVLSHDVALECQVKGTPFPDIHWFK
DGKPLFLGDPNVELLDRGQVLHLKNARRSDKGRYQCTVSNAAGKQAKDIKLTIYIPPSIK
GGNVTSDISVLINSIIKLECETRGLPMPAITWYKDGQPIMSSSQALYIDKGQYLHIPRAQ
VSDSATYMCHVVNVAGTAEKSFHVDVYVPPMIEGDLAMLLNKQVVIAHSLTLECKAAGNP
SPILTWLKDGVPVKANDNIHIEAGGKKLEIMSAQEIDQGQYICVATSVAGEKEIKYEVDV
LVPPAIEGGDETSYFIVMVNNLLELDCHVTGSPPPTIMWLKDGQLIDERDGFKILLNGRK
LVIAQAQVSDTGLYRCMATNTAGDHKKEFEVTVHVPPTIKSSGLSERVVVKYKPVTLQCI
ANGIPNPSITWLKDDQPVNTAQGNLKIQSSGRVLQIAKTLLEDAGRYTCVATNAAGETQQ
HIQLHVHEPPSLEDAGKMLNETVVVSNPVQLECKAAGNPVPVITWYKDNRLLSGSTSMTF
LNRGQIIDIESAQISDAGIYKCVAINSAGATELFYSLQVHVAPSISGSNNMVAVVVNNPV
RLECEARGIPAPSLTWLKDGSPVSSFSNGIQVLSGGRILALTSAQISDTGRYTCVAVNAA
GEKQRDIDLRVYVPPNIMGEEQNVSVLISQAVELLCQSDAIPPPILTWLKDGHPLLKKPG
LSISENGSVLKIEDAQVQDTGRYTCEATNVAGKTEKNYNVNIWAVPPNIGGSDELTQLTV
IEGNLISLLCESSGIPPPNLIWKKKGSPVLTDSMGRVRILSGGRQLQISIAEKSDAALYS
CVASNVAGTAKKEYSLQVYIRPTITNSGSHPTEIIVTRGKSISLECEVQGIPPPTVSWMK
DGRPLIKAKGVEILDEGHILQLKNIHVSDTGRYVCVAVNVAGMTDKKYDLSVHAPPSIIG
NHRSPENISVVEKNSVSLTCEASGIPLPSITWLKDGWPVSLSNSVRILSGGRMLRLMQTR
MEDAGQYTCVVRNAAGEERKIFGLSVLAVPPHILGENTLEDVKVKEKQSVTLTCEVTGNP
VPEITWHKDGQLLQEDEAHHIMSGGRFLQITNAQVSHTGRYTCLASSPAGDKSRSFSLNV
FVSPIIAGVGSDGSPEDVTVILNSPTSLVCEAYSYPPATITWFKDGTPLESNRNIRILPG
GRTLQILNAQKDNAGRYSCVATNEAGEMIKHYEVKVYIPPIINKGDLWGPGLSPKEVKIK
VNNTLTLECEAYAIPSASLSWYKDGQPLKSDDHVNIAANGHTLQIKEAQMSDTGRYTCVA
SNIAGEDELDFDVNIQVPPSFQKLWEIGNMLDTSRSGEAKDVIINNPISLYCETNAAPPP
TLTWYKDGHPLTSSDKVLILPGGRVLQIPRAKVEDAGRYTCVAVNEAGEDSLQYDVRVLV
PPIIKGANSDLPAEVTVLVNKSALMECLSSGSPAPRNSWQKDGQPVLEDDHHKFLSNGRI
LQILNTQIIDIGRYVCVAENTAGSAKKYFNLNVNVPPSVIGPKSENLTVVVNNFISLTCE
VSGFPPPDLSWLKNEQPIKLNTNALIVPGGRTLQIIRAKVSDGGEYTCIAINQAGESKKK
FSLTVYVPPSIKDHDSESLSVVNVREGTSVSLECESNAVPPPVITWYKNGQMITESTHVE
ILADGQMLHIKKAEVSDTGQYVCRAINVAGRDDKNFHLNVYAVPPSIEGPEREVIVETIS
NPVMLTCDATGIPPPTIAWLKNHKHIENSDSLEVHILSGGSKLQIARSQRSDSGNYTCIA
SNMEGRAQKYYFLSIQVPPSVAGAEIPSDVSVLLGENVELVCNANGIPTPVIQWLKDGKP
VASGETERIRVSANGSTLNIYGALTSDTGKYTCVATNPAGEEDRIFNLNVFDTVTPTIRG
NKDEAEKLMTLVDTSINIECRATGTPPPQINWLKNGLPLPLSSHIRLLAAGQVIRIVRAQ
VSDAAVYTCVAANRAGVDNKHYSLQVFAPPNMDNSMGTEEITILKGSSTSMACITHGTPA
PSMAWLRDSQPLGLDAHLTVSTHGMVLQLLKAETEDSGKYTCIASNEAGEVSKHFILKVL
EPPHINGSEEHEEISVIVNNPLELACIASGIPAPKMTWMKDGRPLPQTDQLQTLEGGEVL
RISTAQVEDTGRYTCLASSPAGDDDKEYLVRVHDPVPPNIAGTDEPQDVTVLRNRQVTLE
CKSDAVPPPVITWLKNGERLQATPRVRILSGGRYLQINNADLGDTANYTCVASNIAGKTT
REFILTVNVPPNIKGGPQSLVILLNKSTVLECIAEGVPTPRITWRKDGAVLAGNHARYSI
LENGFLRIQSAHVTDTGRYLCMATNAAGTDRRRIDLQVHVPPSIAPGPTNMTVTVNVQTT
LACEATGIPKPSINWRKNGHLLNVDQNQNSYRLLSSGSLVIISPSVDDTATYECTVANGA
GDDKRTVDLTVQVPPSIADEPTDFLVTKHAPAVITCTASGVPFPSIHWTKNGIRLLPRGD
GYRILSSVGAIEILATQLNHAGRYTCVARNAAGSAHRHVTLHVHEPPVIQPQPSELQVIL
NNPILLPCEATGTPSPFITWQKEGINVITSGKNHAVLPSGSLQISRAVREDAGTYMCVAQ
NPAGTALGKVKLNVQVPPVISPHLKEYVIAVDKPITLPCKADGVPPPDITWHKDGRAIVE
SIRQRVLSSGSLQIAFAQSGDAGHYTCMAANVAGSSSTSTKLTVHVPPRIRSTEGHYTVN
ENSQAILPCIADGIPTPAINWKKDNVLLANLLGKYTAEPYGELILENVVLEDSGFYTCVA
NNAAGEDTHTVSLTVHVLPTFTELPGDVSLNKGEQLRLSCKATGIPLPKLTWTFNNNIIP
AHFDSVNGHSELVIERVSKEDSGTYVCTAENSVGFVKAIGFVYVKEPPVFKGDYPSNWIE
PLGGNAILNCEVKGDPTPTIQWNRKGVDIEISHRIRKLGNGSLAIYGTVNEDAGDYTCVA
TNEAGVVERSMSLTLQRPPIITLEPVETVINAGGKVILNCQATGEPQPTITWSRQGHSIS
WDDRVNMLSNNSLYIADAQKDDTSEFECVARNLMGSVLVRVPVIVQVHGGFSQWSAWRAC
SVTCGKGIQKRSRLCNQPLPANGGKPCQGSDLEMRNCQNKPCPVDGSWSEWTPWEECTRS
CGHGNRTRTRICNNPSAQHGGRPCEGNAVEIIMCNIRPCPVHGAWSTWQPWGTCSGSCGK
GAQTRARLCNNPPPALGGSYCDGAETQMQVCNERHCPIDGKWATWASWSACSVSCGGGAR
QRTRDCSDPVPQYGGRKCEGSDVQSDFCNSDPCPTHGNWSPWSGWGTCSRTCNGGQMRRY
RTCDNPRPSNGGRTCGGPDSQIQRCNTDMCPVDGSWGSWHSWSQCSASCGGGEKTRKRLC
DHPVPAKGGHPCPGDTTQVTRCNVQACPAIGGPQRARGSVIGNINDVEFGIAFLNATITD
SPNSDTRIIRAKITNVPRSLGSAMRKIVSILNPIYWATAKEIGEAVNGFTLTNAVFKRET
QVEFATGEILRMTHIARGLDSDGALLLDIVVSGYVLQLQSPAEVTVKDYTEDYIQTGAGQ
LYAYSTRLFTIDGISIPYTWNHTVFYDQARGRMPFLVETLHASSVESDYNQLEETLGFKI
HASISKGDRSNQCPSGFTLDSVGPFCADEDECAAGNPCSHTCHNAMGTYYCSCPKGLTIA
ADGRTCQDIDECALGRHTCHAGQDCDNTIGSYRCVVHCGAGFRRTSDGLSCQDINECQES
SPCHQRCFNAIGSFYCGCEPGYQLKGRKCMDVNECRQNVCRPDQHCKNTRGGYKCIDLCP
NGMTKAENGTCIDIDECKDGTHQCRYNQICENTRGSYRCVCPRGYRSQGVGRPCMGHGTR
ADINECEQVPKPCAHQCSNTPGSFKCICPPGQHLLGDGKSCAGLERLPNYRTQYSSYNLA
RFSPVRNNYQPQQHYRQYSHLYSSYSEYRNSRTSLSRTRRTIRKTCPEGSEASHDTCVDI
DECENTDACQHECKNTFGSYQCICPPGYQLTLNGKTCQDIDECLEQNVHCGPNRMCFNMR
GSYQCIDTPCPPNYQRDPVSGFCLKNCPPNDLECALSPYALEYKLVSLPFGIATNQDLIR
LVAYTQDGVMHPRTTFLMIDEEQTVPFALRDENLKGVVYTTRPLREAETYRMRVRASSYS
ANGTIEYQTTFIVYIAVSAYPY
Download sequence
Identical sequences ENSPANP00000014783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]