SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014856 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014856
Domain Number 1 Region: 47-157
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-31
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 2 Region: 259-370
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 3 Region: 450-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 164-200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 411-449
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000013
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 6 Region: 211-254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 7 Region: 374-411
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000733
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014856   Gene: ENSPANG00000021263   Transcript: ENSPANT00000019180
Sequence length 859
Comment pep:known_by_projection chromosome:PapAnu2.0:8:99584287:99677751:-1 gene:ENSPANG00000021263 transcript:ENSPANT00000019180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRWSTKESPRWRSALLLLFLAGVYGNGALAEHSENVHISGVSTACGETPEQIRAPSGI
ITSPGWPSEYPAKINCSWFIRANPGEIITISFQDFDIQGSRRCSLDWLTIETYKNIESYR
ACGSTIPPPYISSQDHIWIRFHSDDSVSRKGFRLAYFSGKSEEPNCACDQFRCGNGKCIP
EAWKCNNMDECGDSSDEEICAKEANPPTATAFQPCAYNQFQCLSRFTKVYTCLPESLKCD
GNIDCLDLGDEIDCDVPTCGQWLKYFYGTFNSPNYPDFYPPGSNCTWLIDTGDHRKVILR
FMDFKLDGTGYGDYVKIYDGLEENPHKLLRVLTAFDSHAPLTVVSSSGQIRVHFCADKVN
AARGFNATYQVDGFCLPWEIPCGGNWGCYTEQQRCDGYWHCPNGRDEINCTMCQKEEFPC
SRNGVCYPRSDRCNYQNHCPNGSDEKNCFFCQPGNFHCKNNRCVFESWVCDSQDDCGDGS
DEENCPVIVPTRVITAAVIGSLICGLLLVIALGCTCKLYSLRMFERRSFETQLSRVEAEL
LRREAPPSYGQLIAQGLIPPVEDFPVCSPNQASVLENLRLAVRSQLGFTSVRLPMAGRSS
NIWNRIFNFARSRHSGSLALVSADGDEVVPSQSTSREPERNHTHRSLFSVESDDTDTENE
RRDTAGASGGVAAPLPQKVPPTTAVEATVGACASSSTQSTRGGHADNGRDVTSVEPPSVS
PARHQLTSALSRMTQGLRWVRFTLGRSSSVSQNQSPLRQLDNGVSGREDDDDVEMLIPVS
DGSSDFDVNDCSRPLLDLASDQGQGLRQPYSATNPGVRPSNRDGPCERCGIVHTAQIPDT
CLEVTLKNETSDDEALLLC
Download sequence
Identical sequences A0A096NPC7
ENSPANP00000014856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]