SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014866 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014866
Domain Number 1 Region: 79-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.64e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 136-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000438
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 221-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000182
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000014866
Domain Number - Region: 195-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00131
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 273-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00379
Family EGF-type module 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014866   Gene: ENSPANG00000006061   Transcript: ENSPANT00000019757
Sequence length 439
Comment pep:known_by_projection chromosome:PapAnu2.0:13:102929637:102977558:1 gene:ENSPANG00000006061 transcript:ENSPANT00000019757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPSSPRALFLLLLILACPEPRASQNCLSKQQLLSAIRQLQQLLKGQETRFTEGIRHMKS
RLAALQNSVSRVAPDAPPVSCPALNAPADGRKFGSKYLVDHEVHFACNPGFRLVGPSSVV
CLPNGTWTGEQPRCRDISECSSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAP
EGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCEDVNECELYGQEGRPRLC
MHTCVNTPGSYRCTCPSGYLTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPE
CPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATA
SAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGELILVQTLAGPQTLEVDVDMSEYLDR
SFQANHVSKVTIFVSPYDF
Download sequence
Identical sequences A0A096NPD7
ENSPANP00000014866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]