SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014873 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014873
Domain Number 1 Region: 538-570,650-724
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000188
Family Anti-sigma factor antagonist SpoIIaa 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014873   Gene: ENSPANG00000000830   Transcript: ENSPANT00000013999
Sequence length 779
Comment pep:known_by_projection chromosome:PapAnu2.0:3:129831548:129883562:1 gene:ENSPANG00000000830 transcript:ENSPANT00000013999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPGGRSEPPQLPEYSCSYVVSRPVYSELAFQQQHERRLQERKTLRESLAKCCSCSRKR
AFGVLKTLLPILEWLPKYRVKEWLLSDIVSGVSTGLVATLQGMAYALLAAVPVGYGLYSA
FFPILTYFIFGTSRHISVGPFPVVSLMVGSVVLRMAPDEHFLVSSSNGTVLNTTMIDTAT
RDTARVLIASALTLLVGIIQLIFGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVL
NVSTKNYNGVLSIIYTLVEIFQNIGDTNLADFIAGLLTIVVCMAVKELNDRFRHKIPVPI
PIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFLPPALPPVSLFSEMLAASFSIAVVA
YAIAVSVGKVYATKYDYAIDGNQEFIAFGISNIFSGFFSCFVATTALSRTAVQESTGGKT
QVAGIISAGIVMIAILALGKLLEPLQKSVLAAVVIANLKGMFMQVCDIPRLWRQNKIDAV
IWVFTCIVSIILGLDLGLLAGLVFGLLTVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIE
EPQGVKILRFSSPIFYGNVDGFKCIKSTVGFDAIRVYNKRLKALRKIQKLIKNGQLRATK
NGIISDAGSTNNAFEPDEDIEDPEELDTPTKEIEIQVDWNSELPVKVNVPKVPIHSLVLD
CGAISFLDVVGVRSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFLT
VHDAILYLQNQVKSQEGQDSILETITLIQDCKDTLELIETELTEEELDVQDEAMRTLAS
Download sequence
Identical sequences ENSPANP00000014873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]