SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014934 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014934
Domain Number 1 Region: 448-641
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.38e-42
Family Eukaryotic proteases 0.0000000546
Further Details:      
 
Domain Number 2 Region: 25-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-28
Family Spermadhesin, CUB domain 0.00011
Further Details:      
 
Domain Number 3 Region: 193-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-23
Family Spermadhesin, CUB domain 0.0000467
Further Details:      
 
Domain Number 4 Region: 308-379
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000514
Family Complement control module/SCR domain 0.0000127
Further Details:      
 
Domain Number 5 Region: 141-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000914
Family EGF-type module 0.00047
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000014934
Domain Number - Region: 375-412
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0292
Family Complement control module/SCR domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014934   Gene: ENSPANG00000000599   Transcript: ENSPANT00000016863
Sequence length 644
Comment pep:known_by_projection chromosome:PapAnu2.0:11:7243750:7256668:-1 gene:ENSPANG00000000599 transcript:ENSPANT00000016863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWLLYLLASTLFHRPRNPILIPQRLFGEVTSPLFPKPYPNSFETTTVITVPTGYRVKLVF
QHFDLEPSEGCSHDYVEISADTKNLGRFCGQLGSPLGNPPGKKEFLSQGNKMLLTFHTDF
SNEENGTIMFYKGFLDYYQAVDLDECASQSESGERDPQPQCQHLCNNYVGGGYFCSCCPG
YELQKDRYSCQAECSSELYTEASGYISSLEYPRSYPADLRCNYSIRVERGLTPHLKFVEP
FEIDDHQQVHCPYDQLQIYANGKNIGEFCGKQPPDLDTSSNAVDLLFFTDESGDSRGWRL
PYTTEIIKCPQPKTLDEFTVIQNLQPQYQFRDYFIATCKLGYQLIEGNQVLHSFTAVCQD
DGTWHRAMPRCNIKDCGQPRNLPSYTTTMGVSTYKACIQYYCHEPYYKMQTRAGSRESEQ
KEPVNRPMKEVWRWEEKEKRVFPLSPSVCGKPVHPVEQRQHIIRGQKAKMGNFPWQVFTN
IHGHRGGTLLGDRWILTAAHTLYLKEHDAQSNLPLDVFLGHTNVEELMKLASHPIRRVSI
HPDYRQDESHNFEGDIALLELENSVTLGPNLLPICLPDNKTFYDLGLMGYVSGFGVMEEK
IAHDLRFVHLPVANREDCETWLQGKNRMDVFSNMFCAGHPSLKQ
Download sequence
Identical sequences ENSPANP00000014934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]