SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014947 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014947
Domain Number 1 Region: 185-301
Classification Level Classification E-value
Superfamily TPR-like 1.75e-30
Family Tetratricopeptide repeat (TPR) 0.0016
Further Details:      
 
Domain Number 2 Region: 626-746
Classification Level Classification E-value
Superfamily TPR-like 1.99e-29
Family Tetratricopeptide repeat (TPR) 0.0022
Further Details:      
 
Domain Number 3 Region: 448-557
Classification Level Classification E-value
Superfamily TPR-like 1.83e-25
Family Tetratricopeptide repeat (TPR) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014947   Gene: ENSPANG00000018546   Transcript: ENSPANT00000003905
Sequence length 933
Comment pep:known_by_projection chromosome:PapAnu2.0:8:95451923:95522127:1 gene:ENSPANG00000018546 transcript:ENSPANT00000003905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILNKVLTLKLIYFFLRSGEEGYYPELTEFCEKHLEALAPESRALRKDKPAATAASFTAE
EWEKIDDDIKSWVSEIKKEEDKMHFHETETFPAMKDNLPPVRGSNSCLHVGKEKCSKRPT
KKKTPRDYAEWDKFDVEKECLKIDEDYKEKTVTDKSHLSKMSKIETRIDTAGLTEKEKDF
LAIREKEKGNEAFNSGDYEEAVMYYTRSISALPTVVAYNNRAQAQIKLQNWNSAFQDCEK
VLELEPGNIKALLRRATTYKHQNKLQEAIEDLSKVLDVEPDNELAKKTLSEVERDLKNSE
AISKTQTKGKRMVIQEIENSEDEEGKDSGRKHEDGSGDKKPAGSGGWKLEISRSSNHQQN
HKEKEPAEPAGAARAAQPCAMGNIQKKLTGKAEGGKRPARGAPRRGQTPEAGADKRSPRR
ASAAAAAAGGGATGHPGGGPGAETPAAPLSPAGLKSQGNELFRSGQFAEAASKYSAAIAL
LEPAGSEIADDLSILYSNRAACYLKEGNCSGCIQDCNRALELHPFSMKPLLRRAMAYETL
EQYGKAYVDYKTVLQIDCGLQLANDSVNRLSRILMELEGPNWREKLSPIPAVPASVPLQA
WHPATEMISKQAGDSSSHHQQDTTDEKTFKALKEEGNQCVNDKNYKDALRKYSECLKINN
KECAIYTNRALCYLKLCQFEEAKQDCDQALQLDDGNVKACYRRALAHKGLKNYQKSLTDL
NKVLLLDSSIVEAKMELEEVTRLLNLKDKTASFNKEKERRKIEIQEVNEGNEEEPGRPAG
EVSTGCLASEKGDKSSGSPEDPEKLPIAKPNNAYEFGQIINALSTRKDKEACAHLLAITA
PKDLPMLLSNKLEGDTFLLLIQSLKNNLIEKDPSLVYQHLLYLSKAERFKMMLTLISKGQ
EELIEQLFKDLSDTPNNHFTLEDIQALKRQYEL
Download sequence
Identical sequences ENSPANP00000014947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]