SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014972 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014972
Domain Number 1 Region: 112-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000536
Family Cripto EGF-like domain-like 0.00038
Further Details:      
 
Domain Number 2 Region: 77-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000384
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014972   Gene: ENSPANG00000005381   Transcript: ENSPANT00000023102
Sequence length 187
Comment pep:known_by_projection chromosome:PapAnu2.0:2:88798596:88802267:-1 gene:ENSPANG00000005381 transcript:ENSPANT00000023102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDCRKMARFSSSVIWIMAISKAFELGLVAGLSHQEFARPSRGDLAFRDDSIRPQEEPAIR
PRSSQHVSPMGIQNSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPH
DTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLMMDEHLVASRTPELPPSARTAFMLAGIC
LSIQSYY
Download sequence
Identical sequences A0A096NPP1
ENSPANP00000014972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]