SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015011 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015011
Domain Number 1 Region: 2013-2313
Classification Level Classification E-value
Superfamily BEACH domain 1.44e-125
Family BEACH domain 0.00000000872
Further Details:      
 
Domain Number 2 Region: 2433-2708
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.09e-28
Family WD40-repeat 0.0029
Further Details:      
 
Domain Number 3 Region: 1915-2011
Classification Level Classification E-value
Superfamily PH domain-like 4.36e-27
Family PreBEACH PH-like domain 0.0048
Further Details:      
 
Domain Number 4 Region: 11-367,403-566,890-913,954-1123
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000014
Family Mo25 protein 0.065
Further Details:      
 
Domain Number 5 Region: 598-748
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000292
Family Laminin G-like module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015011   Gene: ENSPANG00000000692   Transcript: ENSPANT00000028182
Sequence length 2723
Comment pep:known_by_projection chromosome:PapAnu2.0:12:64932637:65137006:1 gene:ENSPANG00000000692 transcript:ENSPANT00000028182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRERLFELWMLYCTKKDPDYLKLWLDTFVSSYEQFLDVDFEKLPTRVDDMPPGISLLP
DNILQVLRIQLLQCVQKMADGLEEQQQALSILLVKFFIILCRNLSNVEEIGTCSYINYVI
TMTTLYIQQLKSKKKEKEMADQTSVEEFVIHALAFCESLYDPYRNWRHRISGRSLSTVEK
SRQKYKPASLTVEFIPFFYQCFQESEHLKESLKCCLLHLFGAIVAGGQRNALQAISPATM
EVLMRVLADCDSWEDGDPEEVGRKAELTLKCLTEVVHILLSSNSDQRQVETSTILENYFK
LLNSDHSALPNQRRSRQWENRFIALQIKMLNTITAMLDCTDRPVLQAIFLNSNCFEHLIR
LLQNCKLFLNANNKVADKNEKDLANKLLTEMNEDQVFQGQLDCLAISTIQALTAVMNKSP
AAKEVFKERIGYTHMFEVLKSLGQPPLELLKELMNMAVEGDHTSVGILGISNVQPLLLLI
QWLPELQSHDLQIFISDWLKRICCINRQSRTTCVNANMGIRIIETLDSHSSLHQTCAENL
IAIHGSLGSQSVSSEEIRRLLRLLRVDESESIHPYITPVTRAILTMARKLSLESALQYFD
LSHSMAGISVPPIQKWPGSAFSFSAWFCLDQDQLTLGIANKGGKRKQLYSFFTGSGMGFE
AFITHSGMLVVAVCTKREYATVMLPDHSFCDSLWHNITIVHMPGKRPFGQSFIYIYDNGQ
QKVSAPLRFPAMNEPFTSCCIGSAGQRTTTPPPSQIPDPPFSSPITPHRTSFGGILSSAS
WGGTIEKSKLITKLISAGTQDSEWGCPTSLEGQLGSVIIFYEALQPPQVKALYLAGPNCL
SPWKCQESDMADLPGNILLYYTAKACKNSICLDLSTNCLHGRLTGNKVVNWDIKDIINCI
GGLNVLFPLLEQISHFSEGQIPEEKNESTVPESITPVEGDWLVLTSTKASESRLERNLVA
TFILIVKHFIQRHPINQDNLIHSHGVATLGTLLQKVPSTLMDVNVLMAVQLLIEQVSLEK
NMQLLQQMYQYLLFDFRIWNRGDFPFRIGHIQYLSTIIKDSRRVFRKKYGVQFLLDTLRI
YYGNGCKYNELSLDDIRTIRTSLYGLIKYFLCKGGSHEEIQSIMGYIAATNEEEQLFGIL
DVLFSLLRTSPTRGQLFLLLFEPGNADILYALLLNQKYSDRLREIIFKIMEQMLKCTNVY
ERSKQHIRLREVGYSGLGLLLNEALINTSLIKNLTHQIINTDPVINFKDLLSVVYISHKA
HINVRVAICRKVLHILQSQPDAAHQISQQVGWQDTLVRLFLKAKFENGNTLHKHSRTILM
KDNDKNMSTEDTKKNFDEKTDEEKITSFASVNVSSDQWSLEDRHSLDSNTPLFPEDSSVG
ELSFKSENQEEFWHRNPSHLSLDLSGIDSCEMSDSGSQVPDSLPSTPSPVESTKSFSVHS
DKESSITNDTGFSDDFSLLESQERCEEELLQLLTHILNYVMCKGLEKSDDDTWIERGQVF
SALSKPGISSELLRPSDEIKLTLLQKMLEWAVSENREAKTNPVTAENAFRLMLIIQDFLQ
SEGLVNSNMWTEKLLEDLMLLFDCLSVCYSESPVWVKLSQIQIQLLLGFIGRGNLQVCAM
ASAKLNTLLQTKVIENQDEACYILGKLEHVLSQSIKEQTEIYSFLIPLVRTLVSKIYELL
FMNLHLPSLPFTNGSSSFFEDFQEYCNSNEWQVYIEKYIVPYMKQYETHTFYDGHENMAL
YWKDCYEALMVNMHKRDREGGESKLKFQELFVEPFNRKARQENLRYNNMLKQLSSQQLAT
FRRWKAIQLYLTCERGPWAKRKQNPIHWKLANVENYSRMRLKLVPNYNFKTHEEASALRD
NLGIQHSQPSSDTLLLEVVKQVKVSDMEEDKLDLPEEDISARVNVDEKEEQDQKEKLVLM
EDCELITIIDVIPGRLEITTQHIYFYDGSIEKEDGVGFDFKWPHSQIREIHLRRYNLRRS
ALEIFHVDQSNYFLNFKKEVRNKIYSRLLSLHSPNSYYGSRSPQELFKASGLTQKWVNRE
ISNFDYLIQINTMAGRTYNDLAQYPVFPWILQDYTSEELDLNNPAVFRDLSKPIGVVNEK
NAKAMREKYENFEDPMGTIDKFHYGTHYSNSAGVMHYLIRVEPFTTLHIQLQSGRFDCAD
RQFHSIPATWQALMDNPYDVKELIPEFFYFPEFLENQNQFNLGRLQVSRELVNDVILPKW
AKSAEDFIYKHRKALESEYVSAHLHEWIDLIFGYKQRGPAAVEALNVFYYCSYEGAVDLD
ALTDEKERKALEGMINNFGQTPCQLLKEPHPPRLSAEEAVQKPTKIDTSTLNLFQHLPEL
KSFFIEGISDGIPLLKATVPKNQYRSFMSQGSPELLITISMNSVIGTHGWLPYDRNISNY
FTFIKDQTVTNPKTQRSMNGPFAPGLEVTSKLFVVSHDAKLLFSAGYWDNSIQVMSLTKG
KIISHIIRHMDIVTCLATDYCGIHLISGSRDTTCMIWQITQQGGVPVGLASKPFQILYGH
TDEVLSVGISTELDMTVSGSRDGTVIIHTIQKGQYMRTLRPPCESSLFLTIPNLAISWEG
HIVIYSSIEEKTTLKDKNALHLFSINGKYLGSQILKEQVSDICIIGEHIVTGSLQGFLSI
RDLHSLNLSINPLAMRLPIHCVCVTKECSHILVGLEDGKLIVVGVGKPAEMRSGQLSRKL
WGSSKRLSQISAGETEYNTQDSK
Download sequence
Identical sequences ENSPANP00000015011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]