SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015019 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015019
Domain Number 1 Region: 19-346
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 1.03e-36
Family Tricorn protease domain 2 0.038
Further Details:      
 
Domain Number 2 Region: 225-568
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 9.22e-18
Family DPP6 N-terminal domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 845-976
Classification Level Classification E-value
Superfamily TPR-like 0.000000272
Family Tetratricopeptide repeat (TPR) 0.052
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000015019
Domain Number - Region: 717-827
Classification Level Classification E-value
Superfamily TPR-like 0.0123
Family Tetratricopeptide repeat (TPR) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015019   Gene: ENSPANG00000003767   Transcript: ENSPANT00000017225
Sequence length 1342
Comment pep:known_by_projection chromosome:PapAnu2.0:5:33886976:33985989:1 gene:ENSPANG00000003767 transcript:ENSPANT00000017225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRIFSLLEKTWLGAPIQFAWQKTSGNYLAVTGADYIVKIFDRHGQKRSEINLPGNCVAM
DWDKDGDVLAVIAEKSSCIYLWDANTNKTSQLDNGMRDQMSFLLWSKVGNFLAVGTVKGN
LLIYNRQTSRKIPVLGKHTKRITCGCWNTENLLALGGEDKMITVSNQEGDTIRQTQVRSE
PSNMQFSLMKTDDRTSAAESMISVVLGKKALFLFNLNEPDNPADLEFQQDFGNIVCYNWY
GDGRIMIGFSRGHFVVVSTHTGELGQEIFQARNHKDNLTSIAVSQTLNKVATCGDNCIKI
QDLVDLKDMYAILSLDEENKGLGTLSWTDDGQLLALSTQRGSLHVFLTKLPILGDACSTR
IAYLTSLLEVTVANPIEGELPITVSVDVEPNFVAVGLYHLAVGMNNRAWFYVLGENAVKK
LKDMEYLGTVASICLHSDYAAALFEGKVQLHLIESEILDAQEERETRLFPAVDDKCRILC
HALTSDFLIYGTDTGVVQYFYIEDWQFVNDYRHPVSVKKIFPDPNGTRLVFIDEESDGFV
YCPVNDTTYEIPDFSPTIKGVLWENWPMDKGVFIAYDDDKVYTYVFHKDTIQGAKVILAG
STKVPFAHKPLLLYNGELTCQTQSGKVNNIYLSTYGFLSNFKDTGPDELRPMLAQNLMLK
RFSDAWEMCRILNDEAAWNELARACLHHMEVEFAIRVYRRIGNVGMVMSLEQIKGIEDYN
LLAGHLAMFTNDYNLAQDLYLASSCPIAALEMRRDLQHWDSALQLAKRLAPDQIPFISKE
YAIQLEFAGDYVNALAHYEKGITGDNKEHDEACLAGVAQMSIRMGDIRRGVNQALKHPSR
VLKRDCGAILENMKQFSEAAQLYEKGLYYDKAASVYIRSKNWAKVGDLLPHVSSPKIHLQ
YAKAKEADGRYKEAVVAYENAKQWQSVIRIYLDHLNNPEKAVSIVRETQSPDGAKMVARF
FLQLGDYGSAIQFLVMSKCNNEAFTLAQQHNKMEIYADIIGSEDTTNEDYQSIALYFEGE
KRYLQAGKFFLLCGQYSRALKHFLKCPSSEDNVAIEMAIETVGQAKDELLTSQLIDHLLG
ENDGMPKDAKYLFRLYMALKQYREAAQTAIIIAREEQSAGNYRNAHDVLFSMYAELKSQK
IKIPSEMATNLMILHSYILVKIHVKNGDHMKGARMLIRVANNISKFPSHVVPILTSTVIE
CHRAGLKNSAFSFAAMLMRPEYRSKIDAKYKKKIEGMVRRPDTSEIEEATTPCPFCKFLL
PECELLCPGCKNNIPYCIATGRHMLKDDWTVCPHCDFPALYSELKIMLNTESTCPMCSER
LNAAQLKKISDCTQYLRTEEEL
Download sequence
Identical sequences A0A096NPT7
ENSPANP00000015019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]