SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015047 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015047
Domain Number 1 Region: 309-330,417-494,533-624
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000863
Family FAD/NAD-linked reductases, N-terminal and central domains 0.067
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000015047
Domain Number - Region: 305-345,538-607,661-771
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0298
Family FAD/NAD-linked reductases, N-terminal and central domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015047   Gene: ENSPANG00000018883   Transcript: ENSPANT00000018249
Sequence length 796
Comment pep:known_by_projection chromosome:PapAnu2.0:8:85418743:85441438:1 gene:ENSPANG00000018883 transcript:ENSPANT00000018249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSGVEAPGSSRGLHPSSARKCPKVGSQAWEARPFLGSSARWPRTRLTPGPPPGRLGGP
SSQQLLFRSSLGPRPSRRAPTSLTKSHTEGRRGPDRGPGPDCCRWGRAVCRQTSAPCPRS
LGSVRPGPSPRPRLHQSQTSPAAAAPARRGPRAAAAVAASPPCSAPTAAPGDHPPPAPGS
PQARSGSRYLEADSGATEPGQPRQRRGAGQGRPADPATPSERAPGAGSLAGGGGGGHGGR
ARAPLAQRSMPVWCCRCSLAGHFRNYSDTETEGEIFNSLVQYFGDNLGRKVKAMPLVEET
SLLEDSSVTFPVVIIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILNSKLEEARHLSIVD
QDLEYLSEGLEGRSSNPVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHLVLGKGPP
GGAWHNMEGSMLTISFGSWMELPGLKFKDWVSSKRRNLKGDRVMPEEIARYYKHYVKVMG
LQKNFRENTYITSVSRLYRDQDDDDSQDRDISTKIEKSNFIKRNWEIRGYQRIADGSHVP
FCLFAENVALATGTLDSPAHLEIEGEDFPFVFHSMPEFGAAINKGKLRGKVDPVLIVGSG
LTAADAVLCAYNSNIPVIHVFRRRVTDPSLIFKQLPKKLYPEYHKVYHMMCTQSYSVDSS
LLSDYTSFPEHHVLSFKSDMKCVLQSISGLKKIFKLSAAVVLIGSHPNLSFLKDQGCYLG
HKSSQPITCKGNPVEIDTFTYECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQK
KKQHLFVERGGGDGIA
Download sequence
Identical sequences ENSPANP00000015047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]