SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015070 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015070
Domain Number 1 Region: 152-350
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.89e-70
Family Arfaptin, Rac-binding fragment 0.000000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015070   Gene: ENSPANG00000018884   Transcript: ENSPANT00000015154
Sequence length 373
Comment pep:known_by_projection chromosome:PapAnu2.0:5:142336081:142414215:1 gene:ENSPANG00000018884 transcript:ENSPANT00000015154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQESPKNSAAEIPVTSNGEVDDSREHGFNRDLKHSLPSGLGLSETQITSHGFDNTKEGV
IEAGAFQGSPALPLPSVMSPSRVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNP
AMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQIDILRDNKKKYENILKLAQ
TLSTQLFQMVHTQRQLGDAFADLSLKSLELHEEFGYNADTQKLLAKNGETLLGAINFFIA
SVNTLVNKTIEDTLMTVKQYESARIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAH
KEKYDKMRNDVSVKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLK
TPGVDAPSWLEEQ
Download sequence
Identical sequences A0A096NPY1
ENSPANP00000015070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]