SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015126 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000015126
Domain Number - Region: 175-200
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00102
Family CCCH zinc finger 0.0034
Further Details:      
 
Domain Number - Region: 17-40
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0251
Family CCCH zinc finger 0.0039
Further Details:      
 
Domain Number - Region: 211-234
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0445
Family CCCH zinc finger 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015126   Gene: ENSPANG00000011360   Transcript: ENSPANT00000017367
Sequence length 354
Comment pep:known_by_projection chromosome:PapAnu2.0:X:120647928:120706022:-1 gene:ENSPANG00000011360 transcript:ENSPANT00000017367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCKFAHPPRVCHVENGRVVACFDSLKG
RCTRENCKYLHPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMT
PSLPANPPMAFNPYIPHPGMSLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVC
REFQRGNCTRGENDCRYAHPTDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPAHLQA
KLKAAHHQMNHSAASAMALQPGTLQLIPKRSALEKPNGATPVFNPTVFHCQQALTNLQLP
QPAFIPAGPILCMAPASNIVPMMHGATPTTVSAATTPATSVPFAAPTTGNQAEF
Download sequence
Identical sequences ENSPANP00000015126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]