SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015140 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015140
Domain Number 1 Region: 1045-1382
Classification Level Classification E-value
Superfamily NHL repeat 4.45e-25
Family NHL repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 740-815
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000314
Family Pre-dockerin domain 0.073
Further Details:      
 
Domain Number 3 Region: 1350-1531
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000000628
Family DPP6 N-terminal domain-like 0.03
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000015140
Domain Number - Region: 579-604
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000335
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 549-573
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000437
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 483-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000558
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 415-442
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00186
Family Integrin beta EGF-like domains 0.029
Further Details:      
 
Domain Number - Region: 616-654
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family EGF-type module 0.06
Further Details:      
 
Domain Number - Region: 450-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family Integrin beta EGF-like domains 0.043
Further Details:      
 
Domain Number - Region: 385-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00726
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015140   Gene: ENSPANG00000000764   Transcript: ENSPANT00000023975
Sequence length 2579
Comment pep:known_by_projection chromosome:PapAnu2.0:5:171824177:172017961:1 gene:ENSPANG00000000764 transcript:ENSPANT00000023975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFLILIHLQWIPKKLVVCIYIHVYNEFSFFCFSEQPANNQGQSTLQPLPPSHKQHSAQH
HPSITSLNRNSLTNRRNQSPAPPAALPAELQTTPESVQLQDSWVLGSNVPLESRHFLFKT
GTGTTPLFSTATPGYTMASGSVYSPPTRPLPRNTLSRSAFKFKKSSKYCSWKCTALCAVG
VSVLLAILLSYFIAMHLFGLNWQLQQTENDTFENGKVNSDTMPTNTVSLPSGDNGKLGGF
TQENNTIDSGELDIGRRAIQEVPPGIFWRSQLFIDQPQFLKFNISLQKDALIGVYGRKGL
PPSHTQYDFVELLDGSRLIAREQRSLLETERAGRQARSVSLHEAGFIQYLDSGIWHLAFY
NDGKNAEQVSFNTIVIESVVECPRNCHGNGECVSGTCHCFPGFLGPDCSRAACPVLCSGN
GQYSKGRCLCFSGWKGTECDVPATQCIDPQCGGRGICIMGSCACNSGYKGENCEEADCLD
PGCSNHGVCIHGECHCSPGWGGSNCEILKTMCPDQCSGHGTYLQESGSCTCDPNWTGPDC
SNEICSVDCGSHGVCMGGTCRCEEGWTGPACNQRACHPRCAEHGTCKDGKCECSQGWNGE
HCTIAHYLDKIVKEGCPGLCNSNGRCTLDQNGWHCVCQPGWRGAGCDVAMETLCTDSKDN
EGDGLIDCMDPDCCLQSSCQNQPYCRGLPDPQDIISQSLQSPSQQAAKSFYDRVSFLIGS
DSTHVIPGESPFNKSLASVIRGQVLTADGTPLIGVNVSFFHYPEYGYTITRQDGMFDLVA
NGGASLTLVFERSPFLTQYHTVWIPWNVFYVMDTLVMKKEENDIPSCDLSGFVRPNPIIV
SSPLSTFFRSSPEDSPIIPETQVLHEETTIPGTDLKLSYLSSRAAGYKSVLKITMTQSII
PFNLMKVHLMVAVVGRLFQKWFPASPNLAYTFIWDKTDAYNQKVYGLSEAVVSVGYEYES
CLDLTLWEKRTAILQGYELDASNMGGWTLDKHHVLDVQNGILYKGNGENQFISQQPPVVS
SIMGNGRRRSISCPSCNGQADGNKLLAPVALACGIDGSLYVGDFNYVRRIFPSGNVTSVL
ELRNKDFRHSSNPAHRYYLATDPVTGDLYVSDTNTRRIYRPKSLTGAKDLTKNAEVVAGT
GEQCLPFDEARCGDGGKAVEATLMSPKGMAIDKNGLIYFVDGTMIRKVDQNGIISTLLGS
NDLTSARPLTCDTSMHISQVRLEWPTDLAINPMDNSIYVLDNNVVLQITENRQVRIAAGR
PMHCQVPGVEYPVGKHAVQTTLESATAIAVSYSGVLYITETDEKKINRIRQVTTDGEISL
VAGIPSECDCKNDANCDCYQSGDGYAKDAKLNAPSSLAASPDGTLYIADLGNIRIRAVSK
NKPLLNSMNFYEVASPTDQELYIFDINGTHQYTVSLVTGDYLYNFSYSNDNDITAVTDSN
GNTLRIRRDPNRMPVRVVSPDNQVIWLTIGTNGCLKSMTAQGLELVLFTYHGNSGLLATK
SDETGWTTFFDYDSEGRLTNVTFPTGVVTNLHGDMDKAITVDIESSSREEDVSITSNLSS
IDSFYTMVQDQLRNSYQIGYDGSLRIIYASGLDSHYQTEPHVLAGTANPTVAKRNMTLPG
ENGQNLVEWRFRKEQAQGKVNVFGRKLRVNGRNLLSVDFDRTTKTEKIYDDHRKFLLRIA
YDTSGHPTLWLPSSKLMAVNVTYSSTGQIASIQRGTTSEKVDYDGQGRIVSRVFADGKTW
SYTYLEKSMVLLLHSQRQYIFEYDMWDRLSAITMPSVARHTMQTIRSIGYYRNIYNPPES
NASIITDYNEEGLLLQTAFLGTSRRVLFKYRRQTRLSEILYDSTRVSFTYDETAGVLKTV
NLQSDGFICTIRYRQIGPLIDRQIFRFSEDGMVNARFDYSYDNSFRVTSMQGVINETPLP
IDLYQFDDISGKVEQFGKFGVIYYDINQIISTAVMTYTKHFDAHGRIKEIQYEIFRSLMY
WITIQYDNMGRVTKREIKIGPFANTTKYAYEYDVDGQLQTVYLNEKIMWRYNYDLNGNLH
LLNPSNSARLTPLRYDLRDRITRLGDVQYRLDEDGFLRQRGTEIFEYSSKGLLTRVYSKG
SGWTVIYRYDGLGRRVSSKTSLGQHLQFFYADLTYPTRITHVYNHSSSEITSLYYDLQGH
LFAMEISSGDEFYIASDNTGTPLAVFSSNGFMLKQIQYTAYGEIYFDSNIDFQLVIGFHG
GLYDPLTKLIHFGERDYDILAGRWTTPDIEIWKRIGKDPAPFNLYMFRNNNPASKIHDVK
DYITDVNSWLVTFGFHLHNAIPGFPVPKFDLTEPSYELVKSQQWDDIPPIFGVQQQVARQ
AKAFLSLGKMAEVQVSRRRAGGAQSWLWFATVKSLIGKGVMLAVSQGRVQTNVLNIANED
CIKVAAVLNNAFYLENLHFTIEGKDTHYFIKTTTPESDLGTLRLTSGRKALENGINVTVS
QSTTVVNGRTRRFADVEMQFGALALHVRYGMTLDEEKARILEQARQRALARAWAREQQRV
RDGEEGARLWTEGEKRQLLSAGKVQGYDGYYVLSVEQYPELADSANNIQFLRQSEIGRR
Download sequence
Identical sequences ENSPANP00000015140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]