SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015153 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015153
Domain Number 1 Region: 902-1001,1499-1675
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.02e-36
Family Tandem AAA-ATPase domain 0.0032
Further Details:      
 
Domain Number 2 Region: 434-508
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000454
Family Linker histone H1/H5 0.0052
Further Details:      
 
Domain Number 3 Region: 750-775,803-912
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000143
Family Tandem AAA-ATPase domain 0.0066
Further Details:      
 
Domain Number 4 Region: 646-713
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000146
Family PHD domain 0.0064
Further Details:      
 
Domain Number 5 Region: 254-316,361-391
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000418
Family Tandem AAA-ATPase domain 0.016
Further Details:      
 
Domain Number 6 Region: 1428-1481
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000384
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015153   Gene: ENSPANG00000005684   Transcript: ENSPANT00000019724
Sequence length 1680
Comment pep:known_by_projection chromosome:PapAnu2.0:4:116796090:116867501:1 gene:ENSPANG00000005684 transcript:ENSPANT00000019724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRRKRAPPVRVDEEKRQQLHWNMHEDRRNEPITISDDDEQPCPGSDTSSAHCIILSDS
LKEEVAHRDKKKCSKVVSFSKPIEKEETVGVFSLLSVKLNIVISPYHFDNSWKAFLGELT
LQLLPEQSLTENFSERSITLVSSESSNQFLIYIHSKGEDVEKPMSICDKGILVESSFSGE
MLEDLGWLQKKRRIKLYHKPEGNHIIKVGIYLLEAGLAKLDFLSDANSRMKKFNQLMKKV
MEKLHNYIIPDVLEEDEDDPENEPEGQDIDELYHFVKQTHQQETRSIQVDVQHPALIPVL
RPYQREAVNWMLQQECFRSSPATESALHFLWREIVTSEGLKLYYNPYTGCIIREYPNSGL
QLLGGILADEMGLGKTVEVLALILTHTRQDVKQDALTLPEGKVVNYFIPSHYFGGKLKET
EIQNIEFEPKEKVQCPPTRVMILTAVKEMNGKKGVSILSIYKYVSSIYRYDVQRNRSLLK
RMLKCLIFEGLVKQIKGHGFSGTFTLGKNYKEEDICDKTKKQAVGSPRKIQKESRKSGNK
DTDSEYLPSNTSDDDDDPYYYYYKARRNRSKLRKKPVPSTKKGKSQPFINPHSQGPCPAT
SNSGITDVAMSKSTCISEFSQENETEDCAESLNPDVSDVPPSNTMSPFNTSDYRFECICG
ELDQIDRKPRVQCLKCHLWQHAKCVNYDEKNLKIKPFYCPHCLVAMEPVSTRATLTLSLS
SISFEQIFVAHQLCNSSSTLEHVYQGVKKDGFLQPHFLAEQDIVIITYDVLRSELNYVDI
PHSNSEDGRRLRNQKRYMAIPSPLVAVEWWRICLDEAQMVECPAVKAAEMAQRLSGINRW
CISGTPVQRGLEGNLYGLVVFLGIEPYCVKHWWVRLLYRPYCKKNPQHLYSFIAKILWRS
AKKDVIDQIQIPPQTEEIHWLHFSPVERHFYHRQHEVCCQDAVVKLRKISDWALKLSSLD
RRTVTSILYPLLRLRQACCHPQAVRGEFLPLQKSTMTMEELLTSLQKKCGTECEEAHRQL
VCALNGLAGIHIIKGEYALAAELYREVLRSSEEHKGKLKTDSLQRLHATHNLMELLIAKH
PGIPPTLRDGRLEEEAKQLREHYMSKCNTEVAEAQQALYPVQQTIHELQRKIHSNSPWWL
NVIHRAIEFTIDEELVQRVRNEITSNYKQQTGKLSMSEKFRDCRGLQFLLTTQMEELNKC
QKLVREAVKNLEGPPSRNVIESATVCHLRPARLPLNCCVFCKADELFTEYESKLFSNTVK
GQTAIFEEMIEDEEGLVDDRAPTTTRGLWAISETERSMKAILSFAKSHRFDVEFVDEGST
SMDLFEAWKKEYKLLHEYWMALRNRVSAVDELAMATERLRVRDPREPKPNPPVLHIIEPH
EVEQNRIKLLNDKAVATSQLQKKLGQLLYLTNLEKSQDKTSGGINPEPCPICARQLGKQW
AVLTCGHCFCNECISIIIEQYSVGSHRSSIKCAICRQTTSHKEISYVFTSEKANQEEDIP
VKGSHSTKVEAVVRTLMKIQLRDPGAKALVFSTWQDVLDIISKALTDNNMEFAQISRVKT
FQENLSAFKRDPQINILLLPLHTGSNGLTIIEATHVLLVEPILNPAHELQAIGRVHRIGQ
TKPTIVHRFLIKATIEERMQAMLKTAERSHTNSSVKHSEASVLTVADLADLFTKETEELE
Download sequence
Identical sequences ENSPANP00000015153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]