SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015157 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015157
Domain Number 1 Region: 211-256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family Laminin-type module 0.057
Further Details:      
 
Domain Number 2 Region: 321-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000315
Family EGF-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000015157
Domain Number - Region: 35-91
Classification Level Classification E-value
Superfamily Sialidases 0.0137
Family Sialidases (neuraminidases) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015157   Gene: ENSPANG00000007561   Transcript: ENSPANT00000012935
Sequence length 394
Comment pep:known_by_projection chromosome:PapAnu2.0:1:108208762:108373697:1 gene:ENSPANG00000007561 transcript:ENSPANT00000012935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCNNECDASTPELAHPPELMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSKTIELTD
NIVITFESGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTVLEIIC
TEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDLRIRL
LRPAVGEIFVDELHLARYFYAISDIKVRGRCKCNLHATVCVYDNSKLTCECEHNTTGPDC
GKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISSIGNPPKFNRIWPNISSLEVSNPKQVA
PKLALSTVSSVQVANHKRANVCDNELLHCQNGGTCHNNVRCLCPAAYTGILCEKLRCEEA
GSCGSDSGQGAPPHGSPALLLLTTLLGSASPLVF
Download sequence
Identical sequences ENSPANP00000015157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]