SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015190 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015190
Domain Number 1 Region: 11-135
Classification Level Classification E-value
Superfamily TPR-like 2.48e-23
Family Tetratricopeptide repeat (TPR) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015190   Gene: ENSPANG00000015095   Transcript: ENSPANT00000018911
Sequence length 140
Comment pep:known_by_projection chromosome:PapAnu2.0:13:18916640:18921343:-1 gene:ENSPANG00000015095 transcript:ENSPANT00000018911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGQQGEKSHATLTLAQAHFNKGEYAEAETLYSAYIRQCACAASSGESPGSKCSPEDLAT
AYNNRGQIKYFRVDFYEAMDDYTSAIEVQPNFEVPYYNRGLILYRLGRYFDDALEDFKKV
LDLNPGFQDATLSLKQTILD
Download sequence
Identical sequences ENSPANP00000015190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]