SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015193 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015193
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily PIN domain-like 3.24e-23
Family PIN domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015193   Gene: ENSPANG00000013437   Transcript: ENSPANT00000004887
Sequence length 109
Comment pep:known_by_projection chromosome:PapAnu2.0:7:130790442:130808688:1 gene:ENSPANG00000013437 transcript:ENSPANT00000004887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDCLYAKCIPCITDCVMAEIEKLGQKYRVALRIAKDPRFERLPCTHKGTYADDCLVQRV
TQHKCYIVATVDRDLKRRIRKIPGVPIMYISNHRYNIERMPDDYGAPRF
Download sequence
Identical sequences A0A2I2UZ03 Q66K47
XP_005267787.1.92137 XP_006778937.2.95426 XP_012415546.1.4749 XP_012658901.1.62490 ENSPANP00000015193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]