SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015208 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015208
Domain Number 1 Region: 34-362
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.11e-105
Family Glycosyl hydrolases family 35 catalytic domain 0.0000943
Further Details:      
 
Domain Number 2 Region: 477-518,545-648
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.19e-37
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015208   Gene: ENSPANG00000008353   Transcript: ENSPANT00000028977
Sequence length 683
Comment pep:known_by_projection chromosome:PapAnu2.0:2:173236785:173329710:-1 gene:ENSPANG00000008353 transcript:ENSPANT00000028977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTLALLKMIPKLVTCLCLSPQLDFRHNATRRVFEIAYSQDRFLKDGQPFRYISGSIHYSR
IPRFYWKDRLLKMKMAGLNTIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVI
LRPGPYICAEWEMGGLPAWLLEKEAILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGP
IITVQVENEYGSYFACDFDYLRFLQKRFHHHLGDDVVLFTTDGAHETFLQCGALQGLYAT
VDFGPGSNITDAFQIQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEVVASSLYDILAR
GASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFALRSVIQKFEK
VPEGPIPPSTPKFAYGKISLEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQYYGFVLYR
TTLPQDCSNSTPLSSPFNGVHDRAYVAVDGIPQGVLERNRVITLNITGKAGATLDLLVEN
MGRVNYGAFINDFKGLVSNLTLDSNILTGWTIFPLDTEDAVRSHLGGWEHRASGHHDEAW
AHSSSNYTLPAFYVGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQL
TLFVPQHILVTSAPNTITVLELERAPCSSDGPELCAVEFVDRPVIGSSQIYDHLSKPVEQ
RLMAPPPQKTKIHGWSMYDDESL
Download sequence
Identical sequences ENSPANP00000015208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]