SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015209 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015209
Domain Number 1 Region: 246-326,355-403
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000976
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Domain Number 2 Region: 359-412,547-582,649-703
Classification Level Classification E-value
Superfamily TPR-like 0.00000717
Family Tetratricopeptide repeat (TPR) 0.067
Further Details:      
 
Domain Number 3 Region: 35-64,99-139,216-273
Classification Level Classification E-value
Superfamily TPR-like 0.0000727
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000015209
Domain Number - Region: 575-671
Classification Level Classification E-value
Superfamily TPR-like 0.0645
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015209   Gene: ENSPANG00000023942   Transcript: ENSPANT00000022686
Sequence length 744
Comment pep:known_by_projection chromosome:PapAnu2.0:2:172924255:173026751:1 gene:ENSPANG00000023942 transcript:ENSPANT00000022686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADKPADQGAEKHEGTGQSSGITDQEKELSTNAFQAFTSGNYDACLQHLACLQDINKDD
YKIILNTAVAEFFKSNQTTTDNLRQTLNQLKNQVHSAVEEMDGLDDVENSMLYYNQAVIL
YHLRQYTEAISVGEKLYQFIEPFEEKFAQAVCFLLVDLYILTYQAEKALHLLAVLEKMIS
QGNNNKNGKNETGNNNNKDGSNHKAESGALIEAAKSKIHQYKVRAYIQMKSLKACKREIK
SVMNTAGNSAPSLFLKSNFEYLRGNYRKAVKLLNSSNIAEHPGFMKTGECLRCMFWNNLG
CIHFAMSKHNLGIFYFKKALQENDNVCAQLSAGSADPGKKFSGRPMCTLLTNKRYELLYN
CGIQLLHIGRPLAAFECLIEAVQVYHANPRLWLRLAECCIAANKGTSEQETKGLPSKKGI
VQSIVGQGYHRKIVLASQSIQNTVYNDGQSSAIPVASMEFAAICLRNALLLLPEEQQDPK
QENGAKNSNQLGGNTESSESSETCSSKSHDGDKFIPAPPSSPLRKQELENLKCSILACSA
YVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYAAEALISLDRISDAITHLNPENVT
DVSLGISSNEQDQGSDKGENEAMESSGKRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYD
KARKCLHQAASMIHPKEVPPEAILLAVYLELQNGNTQLALQIIKRNQLLPAVKTHSEVRK
KPVFQPVHPIQPIQMPAFTTVQRK
Download sequence
Identical sequences A0A096NQB5
ENSPANP00000015209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]