SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015224 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015224
Domain Number 1 Region: 235-261,302-547
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.33e-71
Family Nuclear receptor ligand-binding domain 0.000000000934
Further Details:      
 
Domain Number 2 Region: 183-262
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-28
Family Nuclear receptor 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015224   Gene: ENSPANG00000020729   Transcript: ENSPANT00000023666
Sequence length 595
Comment pep:known chromosome:PapAnu2.0:4:110299973:110738195:-1 gene:ENSPANG00000020729 transcript:ENSPANT00000023666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYVDSSKPAVYSYPEGAAY
EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKH
SKKNSPALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
LEMLDAHRLHAPTSRGGAPMEETDQSHLATAGSTSSHSLQKYYITGDAEGFPATV
Download sequence
Identical sequences B6CK19
ENSPANP00000015224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]