SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015227 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000015227
Domain Number - Region: 15-133
Classification Level Classification E-value
Superfamily EF-hand 0.068
Family Calmodulin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015227   Gene: ENSPANG00000021837   Transcript: ENSPANT00000010410
Sequence length 456
Comment pep:known_by_projection chromosome:PapAnu2.0:20:66187910:66208124:-1 gene:ENSPANG00000021837 transcript:ENSPANT00000010410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSGSHVGQSFCSRFLPEEQAEIDRLFDALSSDKNSPNVSSKSFSLKALQNHVGEAVPL
EMVTRLYDGMRRVDLTGKAKGPSENVSQEQFTASMSHLLKGNSEEKSLMIMKMISATEGP
VKAREVQKFTEDLVGSVVHVLSHRQELRGWTGKEAPGPAPRVQVLAAQLLSEMKLQDGKR
FLGPQWLDCDCDRAMIEDWVFRVPHVAIFLSVVIHKGFLVLCSSLDLTTLVPERQVDQGR
GFESILDILSVMYINAHLPREQRHCWRLLFSSELHGHSFSQLCGHITHRGPCVAVLEDHD
KHVFGGFASCSWEVKPQFQGDDRCFLFSICPSMAVYTHTGYNDHYMYLNHGQQTIPNGLG
MGGQHNYFGLWVDVDFGKGHSRAKPTCTTYNSPQLSAHENFQFDKMEVWAVGDPSEEQLA
KGNKSILDADPEAQALLEISGRSRHSEGLREIPDDE
Download sequence
Identical sequences A0A096NQD3
ENSPANP00000015227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]