SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015237 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015237
Domain Number 1 Region: 6-121
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 7.72e-41
Family Pyk2-associated protein beta ARF-GAP domain 0.0014
Further Details:      
 
Domain Number 2 Region: 219-365
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-25
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 122-229
Classification Level Classification E-value
Superfamily PH domain-like 2.22e-17
Family Pleckstrin-homology domain (PH domain) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015237   Gene: ENSPANG00000021960   Transcript: ENSPANT00000017215
Sequence length 374
Comment pep:known_by_projection chromosome:PapAnu2.0:3:33414135:33479227:-1 gene:ENSPANG00000021960 transcript:ENSPANT00000017215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKERRRAVLELLQRPGNARCADCGAPDPDWASYTLGVFICLSCSGIHRNIPQVSKVKSV
RLDAWDEAQVEFLASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIY
PEKQEPYSAGYREGFLWKRGRDNGQFLSRKFVLTEREGALKYFNRNDAKEPKAVMKIEHL
NATFQPAKIGHPHGLQVTYLKDNSTRNIFIYHEDGKEIVDWFNALRAARFHYLQVAFPGA
SDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIG
SKESGYTVLHGFPPSTQGHHWPHGITIVTPDRKFLFACETESDQREWVAAFQKAVDRPML
PQEYAVEAHFKHKP
Download sequence
Identical sequences A0A096NDP0 A0A0D9RY87 A0A2K5L106 A0A2K5UR43 H9FN69
ENSPANP00000015237 XP_005549028.1.63531 XP_008017092.1.81039 XP_011885129.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]