SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015275 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015275
Domain Number 1 Region: 453-508
Classification Level Classification E-value
Superfamily CCCH zinc finger 2.09e-21
Family CCCH zinc finger 0.000029
Further Details:      
 
Domain Number 2 Region: 393-418
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000955
Family CCCH zinc finger 0.0042
Further Details:      
 
Domain Number 3 Region: 421-446
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000222
Family CCCH zinc finger 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015275   Gene: ENSPANG00000021115   Transcript: ENSPANT00000004777
Sequence length 1261
Comment pep:known_by_projection chromosome:PapAnu2.0:19:40362920:40413789:-1 gene:ENSPANG00000021115 transcript:ENSPANT00000004777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPSLPGLPPPGPRGSPPSLSVPLPPRPSSPFSPPCSPDARPATPHLLHHRLPLPDDREDG
ELEEGELEDDGAEETQDTSGGPERSRKEKGEKHHSDSDEEKSHRRLKRKRKKEREKEKRR
SKKRRKSKHKRHASSSDDFSDFSDDSDFSPSEKGHRKYREYSPPYAPSHQQYPPSHATPL
PKKAYSKMDSKSYGMYEDYENEQYGEYEGDEEEDMGKEDYDDFTKELNQYRRAKEGSSRG
RGSRGRGRGYRGRGSRGGSRGRGMGRGSRGRGRGSMGGDHPEDEEDFYEEEMDYGESEEP
MGDDDYDEYSKELNQYRRSKDGRGRGLSRGRGRGSRGRGKGMGRGRGRGGSRGGMNKGGM
NDDEDFYDEDMGDGGGGSYRSRDHDKPHQQSDKKGKVICKYFVEGRCTWGDHCNFSHDIE
LPKKRELCKFYITGFCARAENCPYMHVCHERDFPCKLYHTTGNCINGDDCMFSHDPLTEE
TRELLDKMLADDAEAGAEDEKEVEELKKQGINPLPKPPPGVGLLPTPPRPPGPQAPTSPN
GRPMQGAQMPMPVHEPLSPQQLQQQDMYNKKIPSLFEIVVRPTGQLAEKLGVRFPGPGGP
PGPMGPGPNMGPPGPMGGPMHPDMHPDMHPDMHPDMHPDMHPDMQMGPGMNPGPPMGPGG
PPMMPYGPGDSPHSGMMPPIPPAQNFYENFYQQQEGMEMEPGLLGDAATEDYGHYEELPG
EPGEHLFPEHPLEPDSFSEGGPPGRPKPGAGVPDFLPSAQRALYLRIQQKQLAESSKQDR
ENEEGDTGNWYSSDEDEGGSSVTSILKTLRQQTSSRPPASVGELSSSGLGDPRLQKGHPT
GSRLADPRLSRDPRLTRHAEASGGSGPGDSGPSDPRLARALPTSKPEGSLHSSPVGPSSS
KGSGPPPAEEEEGERALREKAVNIPLDPLPGHPLRDPRSQLQQFSHIKKDVTLSKPSFAR
TVLWNPEDLIPLPVPKQDAVPPVPAALQSMPTLDPRLHRAATAGPPNARQRPGASTDSST
QGANLPDFELLSRILKTVNATGSSATPGSTDKPSDPRVRKAPTDPRLQKPTDSTASSRAA
KPSPAEAPSPTASPSGDASPPATAPYDPRVLAAGGLGQGGGSGQSSVLSGISLYDPRTPN
AGGKATEPAADTGAQPKGAEGNGKSSASKAKEPPFVRKSALEQPETGKAGADGGAPTDRY
NSYGVHNLPVPTLFGTVKQAPKTGSGSPFAGNSPAREGEQDAASLKDVFKGFDPTASPFC
Q
Download sequence
Identical sequences ENSPANP00000015275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]