SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015285 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015285
Domain Number 1 Region: 2-291
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.05e-86
Family BAR domain 0.00046
Further Details:      
 
Domain Number 2 Region: 404-520
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 8.11e-44
Family Pyk2-associated protein beta ARF-GAP domain 0.00021
Further Details:      
 
Domain Number 3 Region: 263-367
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-27
Family Pleckstrin-homology domain (PH domain) 0.0058
Further Details:      
 
Domain Number 4 Region: 673-789
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.05e-24
Family Ankyrin repeat 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015285   Gene: ENSPANG00000011026   Transcript: ENSPANT00000002655
Sequence length 835
Comment pep:known_by_projection chromosome:PapAnu2.0:1:4283930:4300857:-1 gene:ENSPANG00000011026 transcript:ENSPANT00000002655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVEFEECVKDSPRFRATIDEVETDVVEIEAKLDKLVKLCSGMVEAGKAYVSTSRLFVSG
VRDLSQQCQGDTVISECLQRFADSLQEVVNYHMILFDQAQRSVRQQLHNFVKEDVRKFKE
TKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGALTLTRKCFRHLALDYVLQINVLQA
KKKFEILDSMLSFMHAQSSFFQQGYSLLHQLDPYMKKLAAELDQLVIDSAVEKREMERKH
AAIQQRTLLQDFSYDESKVEFDVDAPSGVVMEGYLFKRASNAFKTWNRRWFSIQNSQLVY
QKKLKDALTVVVDDLRLCSVKPCEDIERRFCFEVVSPTKSCMLQADSEKLRQAWVQAVQA
SIASAYRESPDSCYSERLDRTASPSTSSIDSATDPRERGVKGESVLQRVQSVAGNSQCGD
CGQSDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNRAVN
QIYEAQCEGPGSRKPTASSPRQDKEAWIKDKYVEKKFLRKAPMAPALEAPRRWRAQKCPR
PHSSPRVPTARRKVRLEPVLPCVAALSSVGTLDRKFRRDSLFCPDELDSLFSYFDAGAAG
AGPRSLSSDSGLGGSSDGSSDVLAFGSGSVVDSVTEEEGVESEESSGEADGDAEAEAWGL
ADVRELHPGLLAHRAARARDLPALAAALAHGAEVNWADAEDEGKTPLVQAVLGGSLIVCE
FLLQNGADVNQRDSRGRAPLHHATLLGRTGQVCLFLKRGADQHALDQEQRDPLAIAVQAA
NADIVTLLRLARMAEEMREAEAAPGTPGALAGSSPTELQFRRCIQEFISLHLEES
Download sequence
Identical sequences A0A096NQI1
ENSPANP00000015285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]