SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015318 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015318
Domain Number 1 Region: 359-464
Classification Level Classification E-value
Superfamily Second domain of FERM 4.71e-36
Family Second domain of FERM 0.000000825
Further Details:      
 
Domain Number 2 Region: 463-535
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-19
Family Third domain of FERM 0.0000515
Further Details:      
 
Domain Number 3 Region: 313-358
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000248
Family First domain of FERM 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015318   Gene: ENSPANG00000000506   Transcript: ENSPANT00000013874
Sequence length 539
Comment pep:known_by_projection chromosome:PapAnu2.0:1:31139282:31285303:1 gene:ENSPANG00000000506 transcript:ENSPANT00000013874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDLWGLSKQPPAQCPRRTRPHLQPPPLPSCDSRTPLPRPPSPRPADRQLPAPIRGPSGWG
GASRWSCPVSAGGGPGGAKWQEPLKGRERRGARTRSGPVPAAPSPEKSLVTEAENSQHQQ
KEEGEGAINSGQQEPQQEESCQTVAEGDNQFEQKLKASNGDTPTHEDLTKNKERTSESRG
LSRLFSSFLKRPKSQVSEEEGGKEVESDKEKGEGGQKEIEFGTSLDEEIILKAPIAAPEP
ELKTDPSLDLHSLSSAETQPAQEELREDPDFETKEGEGLEECSKIEVKEESPESKAEGEL
KASQKSIRKHRNMHCKVSLLDDTVYECVVETWLDSAKEIKKQVRGVPWNFTFNVKFYPPD
PAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYVSD
FKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDII
LGVCSSGLLVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEVQNLYFLPPKPDTDCI
Download sequence
Identical sequences ENSPANP00000015318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]