SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015319 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015319
Domain Number 1 Region: 308-622
Classification Level Classification E-value
Superfamily TPR-like 1.12e-111
Family Tetratricopeptide repeat (TPR) 0.0000000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015319   Gene: ENSPANG00000011898   Transcript: ENSPANT00000012647
Sequence length 624
Comment pep:known_by_projection chromosome:PapAnu2.0:2:105536240:105775509:1 gene:ENSPANG00000011898 transcript:ENSPANT00000012647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYQGHMQVVGVTLKKKWHCLQKSDLTLALGKGSRAADKAVAMVMKEIPREESAEEKPLLT
MTSQLVNEQQESRPLLSPSIDDFLCETKSEAIARPVTSNTAVLTTGLDLLDLSEPVSQTQ
TKAKKSEPSSKTSSLKKKADGSDLISTDAEQRGQPLRVPETSSLDLDIQTQLEKWDDVKF
HGDRNTKGHPMAERKSCSSRTGSKELLWSSEHRSQPELSGGKSALNSESASELELVAPTQ
ARLTKEHRWGSALLSRNHSLEEEFERAKAAVESDTEFWDKMQAEWEEMARRNWISENQEA
QNQVTISASEKGYYFHTENPFKDWPGAFEEGLKRLKEGDLPVTILFMEAAILQDPGDAEA
WQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQQDACEALKNWIK
QNPKYKYLVKSKKGSPGLTRRMSKSPVDSSVLEGVKELYLEAAHQNGDMIDPDLQTGLGV
LFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFI
RSRYNLGISCINLGAYREAVSNFLTALSLQRKSRNQQQVPHPAISGNIWAALRIALSLMD
QPELFQAANLGDLDVLLRAFNLDP
Download sequence
Identical sequences A0A096NQK9 A0A2K5KL17 A0A2K5Z7A2
ENSPANP00000015319 XP_011827548.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]