SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015338 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015338
Domain Number 1 Region: 622-758
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.68e-36
Family Synaptotagmin-like (S variant) 0.0031
Further Details:      
 
Domain Number 2 Region: 768-899
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.24e-25
Family Synaptotagmin-like (S variant) 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000015338
Domain Number - Region: 5-40
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00345
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015338   Gene: ENSPANG00000010114   Transcript: ENSPANT00000001413
Sequence length 1025
Comment pep:known_by_projection chromosome:PapAnu2.0:14:75682060:75780611:-1 gene:ENSPANG00000010114 transcript:ENSPANT00000001413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIDLSFLTEEEQEAIMKVLQRDAALKRAEEERVRHLPEKIKDDQQLKNMSGQWFYEAKAK
RHRDKIHGADIIRASMRKKRPQVAAEQSKDRANGTKESWVNNVNKDALLPPELAGVVEEP
EEDAAPASPSSSVVNPASTVIDMSQENTKKPNVSPEKQRKNPFNSSKLPEGHSSQQTKNE
QSKNGRTGLFQTSKEDELSESKEKSAVTDTSIQKLEKSKQTVPGLSNGSQIKAPIPKARK
MIYKSTDLNKDDNQSFPRQRTDSLKARGAPRGILKRNSSSSSTDSETLRYNHSFEPKSKI
VSPGLTIHERISEKEHSLEDSSSPNSLEPLKHVRFSAVKDELPQSPGLIHGQEVGEFSVL
ESDRLKNGTEDAGDTEEFQSDPKPSQYGRSLLFHQSASSPNVSKSETHQPVTSGSFPING
LHSHSEVLAARPQSMENSPTINEHKDKSSELTRLESVLPRSPADELSHCVEPEPSQVPGG
SSRDHQQGSKEEPSPVLKTLERSAARKMPSKSLEDISSDSSNQAKVDNQPEELVRSAEDV
STVPTPPDNPFSHPDKLKRMSKSVPAFLQDESDDRETDTASESSYQLSRHKKSPSSLTNL
SSSSGMTSLSSVSGSVMSVYSGDFGNLEVKGNIQFAIEYVESLKELHVFVAQCKDLAAAD
VKKQRSDPYVKAYLLPDKGKMGKKKTLVVKKTLNPVYNEILRYKIEKQILKTQKLNLSVW
HRDTFKRNSFLGEVELDLETWDWDNKQNKQLRWYPLKRKTAPVALEAENRGEMKLALQYV
PEPVPGKKLPTTGEVHIWVKECLDLPLLRGSHLNSFVKCTILPDTSRKSRQKTRAVGKTT
NPIFNHTMVYDGFRPEDLMEACVELTVWDHYKLTNQFLGGLRIGFGTGKSYGTEVDWMDS
TSEEVALWEKMVNSPNTWIEATLPLRMLFDCQDFQMSPNSTGSSTETTKPVESDLENLIS
FLGDFLPARLRCRGYRTVVPASQPVDTAVGAEETGPAAGHISCFILKVMGSKNLFISNMT
LENNG
Download sequence
Identical sequences ENSPANP00000015338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]