SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015355 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015355
Domain Number 1 Region: 140-446
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.77e-111
Family Transglutaminase core 0.0000000718
Further Details:      
 
Domain Number 2 Region: 2-139
Classification Level Classification E-value
Superfamily E set domains 9.1e-39
Family Transglutaminase N-terminal domain 0.0016
Further Details:      
 
Domain Number 3 Region: 602-700
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.8e-23
Family Transglutaminase, two C-terminal domains 0.0011
Further Details:      
 
Domain Number 4 Region: 490-596
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.000000188
Family Transglutaminase, two C-terminal domains 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015355   Gene: ENSPANG00000006291   Transcript: ENSPANT00000013202
Sequence length 701
Comment pep:known_by_projection chromosome:PapAnu2.0:2:90467285:90497095:-1 gene:ENSPANG00000006291 transcript:ENSPANT00000013202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TELKVLLVDFLKQENAVSHHTWEFQTSNPVFRRGQVFHLRLVLNQPLQSYHELKLEFSTG
PNPSIAKHTLVVLDPRTPSDHHNWQATLQNESGKEVTVAVTSTPNAILGKYQLHVKTGKH
ILKSEENILYLLCNPWCKEDTVFMPDEDERKEYILNDTGCHYVGAARSIKYKPWNFGQFE
KNVLDCCISLLTESSLKPTDRRDPVLVCRAMSAMMSFEKGQGVLVGNWTGDYQGGTAPYK
WTGSAPILQQYYSTKQAVCFGQCWVFAGILTTVLRALGIPARSVTAFDSAHDTEKNLTVD
TYVNENGEKITNMSRDSVWNFHVWTDAWMKRPDLPKGYDGWQAVDATPQERSQGVFCCGP
SPLTAIRKGDIFIVYDTRFVFSEVNGDRLIWLVKMVNGQEELHIISMETTSIGKNISTKA
VGQDRRRDITYEYKYPEGGQHHRAPSNSAPESLRPYLYFPCGPLAVVPVPRAIRSGSERE
HRRPVKENFLHMSVQSDDALLGNPVNFTVILKRKTAALQNVNISGSFELQLYTGKKVAKL
CDLNKTSQIQGQVSEVTLTLDSKTYINSLAILDDEPVIRGFIIAEIVESKEIMASEVFVS
FQYPEFSVELPNTGRVGQLLVCNCIFRNTLAIPLTDVKFSLESLGISSLQTSEHGTVQPG
ETIQSQIKCIPIKTGPKKFIIKLSSKQVKEINAQKIVLITK
Download sequence
Identical sequences ENSPANP00000015355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]