SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015368 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015368
Domain Number 1 Region: 237-457
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.29e-54
Family DBL homology domain (DH-domain) 0.000078
Further Details:      
 
Domain Number 2 Region: 448-585
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-19
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 3 Region: 583-657
Classification Level Classification E-value
Superfamily SH3-domain 4.59e-17
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015368   Gene: ENSPANG00000019494   Transcript: ENSPANT00000007920
Sequence length 693
Comment pep:known_by_projection chromosome:PapAnu2.0:12:94701721:94839193:-1 gene:ENSPANG00000019494 transcript:ENSPANT00000007920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKESEDLEKTQRKSRVISASDQQNIDNEPVEVKPELLPEKETSQADQDIQDKEPHSHS
PIKRNSIFNRSIRRRSKAKARDTPERNASCLADSQDNGKSVNESLTLNVPRSRMPPWRTA
VQTGPGAQKMSESSSTPGNGATPEEWPALADSPTTLTEALRMIHPIPADSWRNLIEQIGL
LYQEYRDKSTLQEIETRRQQDAEIEDNTNGSPASEDTALPQICLLSNPHSRFNLWQDLPE
IRSSGVLEILQPEEIKLQEAMFELVTSEASYYKSLNLLVSHFMENERMRKILHPSEAHIL
FSNVLDVLAVSERFLLELEHRMEENIVISDVCDIVYRYAADHFSVYITYVSNQTYQERAY
KQLLQEKAAFRELIAQLELDPKCKGLPFSSFLILPFQRITRLKLLVQNILKRVEERSERE
CTALDAHKELEMVVKACNEGVRKMSRTEQMICIQKKMEFKIKSVPIISHSRWLLKQGELQ
QMSGPKTSRTLRTKKLFHEIYLFLFNDLLVICRQIPGDKYQVFDSAPRGLLRVEELEDQG
QTLANVFILRLLENADDREATYMLKASSQSEMKRWMTSLAPNRRTKFVSFTSRLLDCPQV
QCVHPYVAQQPDELTLELADILNILDKTDDGWIFGERLHDQERGWFPSSMTEEILNPKIR
SQNLKECFRVHKMDDPQRSQNKDRRKLGSRNRQ
Download sequence
Identical sequences ENSPANP00000015368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]