SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015374 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015374
Domain Number 1 Region: 53-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-21
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Domain Number 2 Region: 236-338
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 4.35e-20
Family Platelet-derived growth factor-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015374   Gene: ENSPANG00000025668   Transcript: ENSPANT00000022447
Sequence length 345
Comment pep:known_by_projection chromosome:PapAnu2.0:5:146263356:146476122:-1 gene:ENSPANG00000025668 transcript:ENSPANT00000022447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLRLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHS
PRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSA
LPLDLLNNAITAFSTLEDLIRYLEPDRWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
Download sequence
Identical sequences A0A096NQR2 A0A0D9S1Q9 A0A2K5JYX1 A0A2K5V0S6 A0A2K5ZID6 A0A2K6B0V3 A0A2K6KQ76 A0A2K6QZW2 G7MS74
XP_005556211.1.63531 XP_007998283.1.81039 XP_010356342.1.97406 XP_011751143.1.29376 XP_011815115.1.43180 XP_011825884.1.47321 XP_017726533.1.44346 ENSPANP00000015374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]