SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015440 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015440
Domain Number 1 Region: 960-1169
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-51
Family Thrombospondin C-terminal domain 0.000000709
Further Details:      
 
Domain Number 2 Region: 834-959
Classification Level Classification E-value
Superfamily TSP type-3 repeat 6.93e-32
Family TSP type-3 repeat 0.000000568
Further Details:      
 
Domain Number 3 Region: 25-203
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.18e-31
Family Laminin G-like module 0.0000646
Further Details:      
 
Domain Number 4 Region: 766-836
Classification Level Classification E-value
Superfamily TSP type-3 repeat 6.02e-17
Family TSP type-3 repeat 0.00023
Further Details:      
 
Domain Number 5 Region: 493-544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.7e-16
Family TSP-1 type 1 repeat 0.00012
Further Details:      
 
Domain Number 6 Region: 436-491
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000112
Family TSP-1 type 1 repeat 0.0000813
Further Details:      
 
Domain Number 7 Region: 318-376
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000126
Family VWC domain 0.0047
Further Details:      
 
Domain Number 8 Region: 693-777
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000131
Family TSP type-3 repeat 0.00013
Further Details:      
 
Domain Number 9 Region: 382-430
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000353
Family TSP-1 type 1 repeat 0.00095
Further Details:      
 
Domain Number 10 Region: 549-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000435
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015440   Gene: ENSPANG00000010325   Transcript: ENSPANT00000011074
Sequence length 1171
Comment pep:known_by_projection chromosome:PapAnu2.0:4:164236968:164271544:-1 gene:ENSPANG00000010325 transcript:ENSPANT00000011074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWGLVLLALWVWPSTQAGHQDKGTTFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYIPPVNAEDLSKITRIMRQKEGFFLTAQLKQDGKSRGTLLALEGPGLSQRQFEIVSNGP
ADTLDLIYWIDGTRHVVSLEDVGLADSQWKNVTVQVAGETYSLHVGCDLIDSFALDEPFY
EHLQAEKSRMYVAKGSARESHFRHMYSHSHMSYIGTYTDMWTKQVCLESQQAEINAISEN
TETLRLGPHVTTEYVGPSSERRPEVCERSCEELGNMVQELSGLHVLVNQLSENLKRVSND
NQFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTTCTCKKFKTICHQITCPPATC
ASPSFMEGECCPSCLHSVDGEEGWSPWAEWTECSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRACSLSKCDTRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSG
RETKACQGAPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQYGGKACVGDVQER
QMCNKRSCPMDGCLSNPCFPGAQCSSFPDGSWSCGSCPVGFLGNGTHCEDLDECALVPDI
CFSTSKVPRCVNTQPGFHCLPCPPRYRGSQPTGVGLEAAKTEKQVCEPENPCKDKTHNCH
KHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYHCIKDNC
PHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKDEVGDRCDNCP
YVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
VHNPDQTDMDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDNDGQGDACDHDD
DNDGVPDDRDNCRLVFNPDQEDLDVCIGDGRGDICKDDFDNDNVPDIDDVCPENNAISET
DFRNFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGESVSHGGGASVALGEA
PTEDADCALRSCSWILNPFNSNNLMVKEPTGDEEGSPPRPLGIHSQMVTEPSWGLPETYR
HCAWGYNSTHVRTLWHDPRNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPIY
DQTYAGGRLGLFVFSQEMVYFSDLKYECRGE
Download sequence
Identical sequences ENSPANP00000015440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]