SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015464 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015464
Domain Number 1 Region: 29-253
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.74e-58
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.00027
Further Details:      
 
Domain Number 2 Region: 355-671
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-41
Family Extended AAA-ATPase domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015464   Gene: ENSPANG00000021001   Transcript: ENSPANT00000023325
Sequence length 772
Comment pep:known_by_projection chromosome:PapAnu2.0:13:107169726:107205155:1 gene:ENSPANG00000021001 transcript:ENSPANT00000023325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEVKYLQLAEELIRPERNT
LVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKDFYVAFQDLPTR
HKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNIC
RNPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGD
KCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLA
CCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHG
NDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTS
GKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDVRDQVAIHEAMEQQ
TISITKAGVKATLNARTSILAAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDEC
NEVTDYAIARRIVDLHSRIEESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKH
LRQRDGSGVTKSSWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVE
TPDVNLDQEEEIQMEVDEGAGGINGHADSPAPVNGINGYSEDINQESAPKASLRLGFSEY
CRISNLIVLHLRKVEEGEAYLVLLTCSVTSVSSVHIGHLCLPNFVLFCWKKG
Download sequence
Identical sequences ENSPANP00000015464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]