SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015488 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000015488
Domain Number - Region: 519-868,918-991
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00759
Family Hermes transposase-like 0.038
Further Details:      
 
Domain Number - Region: 74-106
Classification Level Classification E-value
Superfamily SET domain 0.00899
Family Viral histone H3 Lysine 27 Methyltransferase 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015488   Gene: ENSPANG00000019134   Transcript: ENSPANT00000019801
Sequence length 1051
Comment pep:known_by_projection chromosome:PapAnu2.0:14:19948471:19957251:-1 gene:ENSPANG00000019134 transcript:ENSPANT00000019801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGQCYFSRQGSCSADVHTGPHACGLLTNHTCPALGRHQRALNKGWPMRSHLSPLPARY
VVISREEREQNLLAFQHSERIYFRACRDIRPGEWLRVWYSEDYMKRLHSMSQETIHRNLV
RGEKRLQREKSEQALDNPEDLRGPIHLPVLRQGKSPYKRGFDEGDVHPQAKKKKIDLIFK
DVLEASLESAKVEAHQLALSTSLVIRKVPKYQDDAYSRCATTMTHGVQNIGRTQGEGDRK
VPQGVSKEPGQLEDEEEEPSSFKADSPAEASLASDPHELPTTSFCPNCIRLKKKVRELQA
ELDMLKSGKLPEPPALPPQVLELPEFSDPAASESMVSGPAIMEDDDQEVDSADESVSNDM
MTATDEPSKMSSATGRRIRRFKQEWLKKFWFLRYSPTLNEMWCHVCRQYTVQSSRTSAFI
IGSKQFKIHTIKLHSQSNLHKKCLQLYKLRMHPEKTEEMCRNMTLLFNTAYHLALEGRPY
LDFRPLAELLRKCELKVVDQYMNEGDCQILIHHIARALREDLVERIRQSPCLSIILDGQS
DDLLADTVAVYVQYTSSDGPPATEFLSLQELGFSSTESYLQALDRAFSALGIRLQDEKPT
VGLGVDGANITASLRASMFMTIRKTLPWLLCLPFMVHRPHLEILDAISGKELPCLEELEN
NLKQLLSFYRYSPRLMCELRSTAATLCEETEFLGDIRAVRWIIGEQNVLNALIKDYLEVV
AHLKEVSSQTQRADASAIALALLQFLMDYQSIKLIYFLLDVIAVLSRLAYIFQGEYLLVS
QVDDKIEEAIQEISRLADSPGEYLQEFEENFRESFNGIAMKNLRVAEAKFQSIREKICQK
TQVILAQRFDSRSRIFVKACQVFDLAAWPRSSEELMSFGKEDMVQIFDHLEAIPTFSRDV
CREGLDPRGSLLMEWRELKADYYTKNGFKDLISHICKYKQRFPLLNKIIQVLKVLPTSTV
CCEKGRNALQRVRKNHRSRLTLEQLSDLLTIAVNGPPIANFDAKRALDSWFEEKSGNSYA
LSAEVLSRMSALEQKPALQTVDHGTEFYPDI
Download sequence
Identical sequences ENSPANP00000015488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]