SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015499 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015499
Domain Number 1 Region: 426-839
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.28e-124
Family RNB domain-like 0.00000000321
Further Details:      
 
Domain Number 2 Region: 225-319,369-417
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.11e-28
Family Cold shock DNA-binding domain-like 0.00057
Further Details:      
 
Domain Number 3 Region: 63-200
Classification Level Classification E-value
Superfamily PIN domain-like 0.00000000000000196
Family PIN domain 0.014
Further Details:      
 
Domain Number 4 Region: 845-921
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000171
Family Cold shock DNA-binding domain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015499   Gene: ENSPANG00000010053   Transcript: ENSPANT00000029143
Sequence length 955
Comment pep:known_by_projection chromosome:PapAnu2.0:17:50421179:50449165:-1 gene:ENSPANG00000010053 transcript:ENSPANT00000029143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKSKTFLKKTRAGGVMKIVREHYLRDDIGCGAPGCAACGGAHEGPALEPQPQDPASSLC
PQPHYLLPDTNVLLHQIDVLEDPAIRNVIVLQTVLQEVRNRSAPVYKRIRDVTNNQEKHF
YTFTNEHHRETYVEQEQGENANDRNDRAIRVAAKWYNEHLKKMSADNHLQVIFITNDRKN
KEKAVEEGIPAFTCEEYVKSLTANPELIDRLACLSEEVNEIESGKIIFSEHLPLSKLQQG
IKSGIYLQGTFRASRENYLEATVWIHGDNEENKEIILQGLKHLNRAVHEDIVAVELLPKS
QWVAPSSVVLQDEAQNEEDVEKEEERERMVSLLSDLLHKIIVLIFNTCHIHNINSWNTYN
SFYILLFPSFIFIALESHCIIIHGESRPLDSIKRNHLVTFIVGISNNASWFQGHFVRNLG
DVGEKETETEVLLLEHDVPHQPFSQAVLSFLPKMPWSITEKDMKNREDLRHLCICSVDPP
GCTDIDDALHCRELENGNLEVGVHIADVSHFIRPGNALDQESARRGTTVYLCEKRIDMVP
ELLSSNLCSLKCDVDRLAFSCIWEMNHNAEILKTKFTKSVINSKASLTYAEAQLRIDSAN
MNDDITTSLRGLNKLAKILKKRRIEKGALTLSSPEVRFHMDSETHDPIDLQTKELSGRET
NSMVEEFMLLANISVHEEFSEHALLRKHPAPPPSNYEILVKAARSRNLEIKTDTAKSLAE
SLDRAESPTFPYLNTLLRILATRCMMQAVYFCSGMDNDFHHYGLASPIYTHFTSPIRRYA
DVIVHRLLAVAVGADCTYPELTDKHKLADICKNLNFRHKMAQYAQRASVAFHTQLFFKSK
GIVSEEAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPNPRLIYDDEIPSLKIEDTVFHV
FDKVKVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSNTDLNGPEKKKIKLGK
Download sequence
Identical sequences ENSPANP00000015499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]