SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015511 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015511
Domain Number 1 Region: 247-381
Classification Level Classification E-value
Superfamily TPR-like 0.000000000345
Family Tetratricopeptide repeat (TPR) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015511   Gene: ENSPANG00000008402   Transcript: ENSPANT00000027210
Sequence length 410
Comment pep:known_by_projection chromosome:PapAnu2.0:13:36909178:37008542:1 gene:ENSPANG00000008402 transcript:ENSPANT00000027210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHSTNKELIFGIMVGTAGISLLLLWYHKVRKPEKAMKLPKFLSLDNTFNSITLQDEIHN
DQGTTVIFQERQLQILEKLNELLTNMEELKEEIRFLKETVPKLEEYIQDELGGKITVHKV
SPQHRARKRRLPTIQSSATSNSSEEAESEGGYITANTDTEEQSFPVPKAFNTHVEELNLD
VLLQKVDHLRMNESGKSESFELLCDHKEKFRDEIEFMWRFARAYGDMYELSTNTQEKKHY
ANIGRTLSERAINRAPMNGHCHLWYAVLCGYVSEFEGLQNKINYGHLFKEHLDIAIKLLP
EEPFLYYLKGRYCYTVSKLSWIEKKMAATLFGKIPSSTVQEALHNFLKAEELCPGYSNPN
YMYLAKCYADLEENQNALKFCNLALLLPTVTKEDKEAQKEMQKIMTSLKR
Download sequence
Identical sequences A0A096NR41
ENSPANP00000015511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]