SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015526 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015526
Domain Number 1 Region: 43-191
Classification Level Classification E-value
Superfamily TPR-like 6.83e-48
Family Tetratricopeptide repeat (TPR) 0.000000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015526   Gene: ENSPANG00000020761   Transcript: ENSPANT00000011850
Sequence length 194
Comment pep:known_by_projection chromosome:PapAnu2.0:3:42095030:42100219:-1 gene:ENSPANG00000020761 transcript:ENSPANT00000011850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRGVARSCPHPPDAGSGSPPLPLGHGDCGTVDCSVRLTGAVAMEAVLNELVSVEDLLKFE
KKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLA
VGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAG
LAGLIGLAVSKSKS
Download sequence
Identical sequences ENSPANP00000015526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]