SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015527 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015527
Domain Number 1 Region: 478-686
Classification Level Classification E-value
Superfamily vWA-like 3.76e-54
Family Integrin A (or I) domain 0.00023
Further Details:      
 
Domain Number 2 Region: 303-496
Classification Level Classification E-value
Superfamily vWA-like 6.68e-46
Family Integrin A (or I) domain 0.00086
Further Details:      
 
Domain Number 3 Region: 41-135
Classification Level Classification E-value
Superfamily LCCL domain 7.72e-30
Family LCCL domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015527   Gene: ENSPANG00000004977   Transcript: ENSPANT00000028664
Sequence length 693
Comment pep:known_by_projection chromosome:PapAnu2.0:13:35668378:35793613:1 gene:ENSPANG00000004977 transcript:ENSPANT00000028664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTVVLTMKASVIEMFLVLLVTGVHSNKETSKKIKRPKFTVPQINCDVKAGKIINPEFIV
KCPAGCQDPKFHVYGTDVYASYSSVCGAAVHSGVLDNSGGKILVRKVAGLSGYKGSYSNG
VQSLSLPRWRESFIVLESKPKKGVTYPSALTYSSSKSPAAQAGETTKAYQRPPIPATTAQ
PVTLMQLLAVTVDVATPTILPRPSPSAASTTSIRRPEPVGHRSQEMDLWSTTTYTSSQNR
PGADPGIQRQDPSGAAFEKPVRADVSLGEMDSWKPGSVLLDEGRVPKEELSTQSLEPVSL
GDPNCKIDLSFLIDGSTSIGKRRFRIQKQLLAGVAQALDIGPAGPLMGVVQYGDNPATHF
NLKTHMNSRDLKTAIEKITQRGGLSNVGRAISFVTRNFFSKANGNRSSAPNVVVVMVDGW
PTDKVEEASRLARESGINIFFITIEGAAENEKQYVVEPNFANKAVCRTNGFYSFHVQSWF
GLHKTLQPLVKRVCDTDRLACSKTCLNSADIGFVIDGSSSVGTGNFRTVLQFVTNLTKEF
EISDTDTRVGAVQYTYEQRLEFGFDQYSSKPDILNAIKRVGYWSGGTSTGAAINFALEQL
FKKSKPNKRKLMILITDGRSYDDVRIPAMAAHLKGVITYAIGVAWAAQEELEVIATHPAR
DHSFFVDEFDNLYQYVPRIIQNICTEFNSQPRN
Download sequence
Identical sequences A0A096NR57
ENSPANP00000015527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]