SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015537 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015537
Domain Number 1 Region: 1122-1219
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.88e-34
Family CUT domain 0.0000122
Further Details:      
 
Domain Number 2 Region: 947-1034
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.81e-32
Family CUT domain 0.000022
Further Details:      
 
Domain Number 3 Region: 548-631
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 3.5e-29
Family CUT domain 0.0000532
Further Details:      
 
Domain Number 4 Region: 1249-1312
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000018
Family Homeodomain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000015537
Domain Number - Region: 132-342
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.045
Family BAR domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015537   Gene: ENSPANG00000016879   Transcript: ENSPANT00000004921
Sequence length 1392
Comment pep:known_by_projection chromosome:PapAnu2.0:3:42683001:43111510:1 gene:ENSPANG00000016879 transcript:ENSPANT00000004921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAANVGSMFQYWKRFDLQQLQRELDATATVLANRQDESEQSRKRLIEQSREFKKNTPEDL
RKQVAPLLKSFQGEIDALSKRSKEAEAAFLNVYKRLIDVPDPVPALDLGQQLQLKVQRLH
DIETENQKLRETLEEYNKEFAEVKNQEVTIKALKEKIREYEQTLKNQAETIALEKEQKLQ
NDFAEKERKLQETQMSTTSKLEEAEHKVQSLQTALEKTRTELFDLKTKYDEETTAKADEI
EMIMTDLERANQRAEVAQREAETLREQLSSANHSLQLASQIQKAPDVEQAIEVLTRSSLE
VELAAKEREIAQLVEDVQRLQASLTKLRENSASQISQLEQQLSAKNSTLKQLEEKLKGQA
DYEEVKKELNILKSMEFAPSEGAGTQDAAKPLEVLLMEKNRSLQSENAALRISNSDLSGS
ARRKGKDQPESRRPGSLPAPPPSQLPRNPGEQASNTNGTHQFSPAGLSQDFFSSSLASPS
LPLASTGKFALNSLLQRQLMQSFYSKAMQEAGSTSMIFSTGPYSTNSISSQSPLQQSPDV
NGMAPSPSQSESAGSVSEGEEMDTAEIARQVKEQLIKHNIGQRIFGHYVLGLSQGSVSEI
LARPKPWNKLTVRGKEPFHKMKQFLSDEQNILALRSIQGRQRENPGQSLNRLFQEVPKRR
NGSEGNITTRIRASETGSDEAIKSILEQAKRELQVQKTAEPAQPSSASGSGNSDDAIRSI
LQQARREMEAQQAALDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSA
VPEAGASTLPNPPALKKEAQEAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDHWWSAVQ
PERRNAASSEEAKAEETGGGKEKGSGGSGGGSQPRAERSQLQGPSSSEYWKEWPSAESPY
SQSSELSLTGASRSETPQNSPLPSSPIVPMSKPTKPSVPPLTPEQYEVYMYQEVDTIELT
RQVKEKLAKNGICQRIFGEKVLGLSQGSVSDMLSRPKPWSKLTQKGREPFIRMQLWLNGE
LGQGVLPVQGQQQGPVLHSVTSLQDPLQQGCVSSESTPKTSASCSPAPESPMSSSESVKS
LTELVQQPCPPIEASKDGKPPEPSDPPASDSQPATPLPLSGHSALSIQELVAMSPELDTY
GITKRVKEVLTDNNLGQRLFGETILGLTQGSVSDLLARPKPWHKLSLKGREPFVRMQLWL
NDPNNVEKLMDMKRMEKKAYMKRRHSSVSDSQPCEPPSVGTEYSQGASPQPQHQLKKPRV
VLAPEEKEALKRAYQQKPYPSPKTIEDLATQLNLKTSTVINWFHNYRYGWLPRSARSTQG
KGLMCPEAAMVHRGEAPGGWELGDWSVPWSLRFVGFFGGFFFLFFFRRRFNLVAQAGVQW
CNLGSLQPVSWV
Download sequence
Identical sequences ENSPANP00000015537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]