SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015625 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015625
Domain Number 1 Region: 23-142
Classification Level Classification E-value
Superfamily FKBP-like 2.95e-29
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 
Domain Number 2 Region: 168-317
Classification Level Classification E-value
Superfamily TPR-like 6.33e-21
Family Tetratricopeptide repeat (TPR) 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015625   Gene: ENSPANG00000010879   Transcript: ENSPANT00000007321
Sequence length 327
Comment pep:known_by_projection chromosome:PapAnu2.0:3:44381263:44395366:1 gene:ENSPANG00000010879 transcript:ENSPANT00000007321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVK
YSGYLEHMDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGT
LGCPPLIPPNTTVLFEIELLDFLDSAESDKFCALSAEQQDQYPLQKVLKVAATEREFGNY
LFRQNRFCDAKVRYKRALLLLRRRSAPSEAQHLVEAAKLPVLLNLSFTYLKLDRPTIALR
YGEQALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQREQPFNHDINNELKKLASDY
RDYVDKEKEMWHRMFARCGDGSTAGES
Download sequence
Identical sequences A0A096NRF5 A0A2K5N8R8 A0A2K6AFM7 A0A2K6BC79 G7P173
XP_005549412.1.63531 XP_011765607.1.29376 XP_011831714.1.47321 XP_011931833.1.92194 ENSPANP00000015625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]