SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015626 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015626
Domain Number 1 Region: 147-304
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.12e-29
Family Dual specificity phosphatase-like 0.00072
Further Details:      
 
Domain Number 2 Region: 3-153
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.00000000000000492
Family Cell cycle control phosphatase, catalytic domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015626   Gene: ENSPANG00000008065   Transcript: ENSPANT00000019980
Sequence length 314
Comment pep:known_by_projection chromosome:PapAnu2.0:3:43800616:43838532:1 gene:ENSPANG00000008065 transcript:ENSPANT00000019980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLLLCEPTELYNILNQATKLSRLTEPNYLCLFDVRSKWEYDESHVITALRVKKKKNNE
YLLPESVDLECVKYCVVYDNNTSTLEVLLKDDDDDSDSDSAGKDVVPGAAIEYGRILTRL
TRHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIMPGEVFLGNFSQACDP
KIQKDLKIKAHVNVSMDTGPFFAGDPDRLLHIQIEDSPEAQILPFLRHMCHFIDVHLHLG
SVILVFSTQGISRSCAAIIAYLMHCNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKT
ILGDSVTNIMDPLY
Download sequence
Identical sequences ENSPANP00000015626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]