SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015628 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015628
Domain Number 1 Region: 451-527
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000072
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015628   Gene: ENSPANG00000025451   Transcript: ENSPANT00000004737
Sequence length 629
Comment pep:known_by_projection chromosome:PapAnu2.0:20:71540749:71583984:1 gene:ENSPANG00000025451 transcript:ENSPANT00000004737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVPLASSEAQTVQSLGFAIYRALDWGLDESEERELSPQLERLIDLMANNDSEDSGCGAA
DEGYGGPEEEEEAEGVPRSVRTFAQAMRLCAARLTDPRGAQAHYQAVCRALFVETLELRA
FLARVREAKEMLQKLREDEPQVETPQAELDSLGHTDWARLWVQLMRELRHGVKLKKVQEQ
EFNPLPTEFQLTPFEMLMQDIRARNYKLRKVMVDGDIPPRVKKDAHELILDFIRSRPPLK
QVSERRLRPLPPKQRSLHEKILEEIKQERRLRPVQGEGWAARGFGSLPCILNACSGDAKS
TSCINLSVTDAGGSAQRPRPRVLLKAPTLAEMEEMNTSEEEESPCGEVTLKRDRSFSEHD
LAQLRSEVASGLQSATQPPGGMEPPRPRAGSARVWRPGARDQGTCPASVSDSSHPLLSNR
GSSVDRPEASMTPDAKHLWLEFSHPVESLALTVEEVMDVRRVLVKAEMEKFLQNKELFSS
LKKGKICCCCRAKFPLFSWPPTCLFCKRAVCTSCSIKMKMPSKKFGHIPVYTLGFESPQR
ASAAKTTPVQRRDTFQSLQGPQWQSVEEAFPHIYAHGCVLKDVCSECTSFVADVVRSSRK
SVDVLNTTPRRSRQTQSLYIPNTRTLDFK
Download sequence
Identical sequences ENSPANP00000015628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]