SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015636 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015636
Domain Number 1 Region: 371-834
Classification Level Classification E-value
Superfamily TPR-like 0.00000483
Family BTAD-like 0.081
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000015636
Domain Number - Region: 1072-1121
Classification Level Classification E-value
Superfamily TPR-like 0.0284
Family Tetratricopeptide repeat (TPR) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015636   Gene: ENSPANG00000010337   Transcript: ENSPANT00000021732
Sequence length 1164
Comment pep:known_by_projection chromosome:PapAnu2.0:7:146381044:146433959:-1 gene:ENSPANG00000010337 transcript:ENSPANT00000021732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALFPAFAGISEAPDSGSSRKELDWLSNPSFCVGSITSLSQQTEAAPAHVSEGSPLTRSP
LKSEPSDESDTDKKLKQISRKKKKEKKKKRKHQHHKKTKRKHGQSSSSRSETDTDSEKDK
PSRGVVGSKRQSEKPNQGNNAAADTGHRFVWLEDIQAVTGETFRTDKKPDPANWEYKSLY
RGDIARYKRKGDSCLGINPKKQCISWEGTSTEKKHSRKQVERYFTKKSVGLMNIDGAAIS
SKTEPPSSEPISFIPVKDLEDAAPVTTWLNPLGIYDQSTTQWLQGQGPPEQESKQPDTQP
DSESAALKAKVEEFNRRVRENPRDTQLWMAFVDFQDEVMKSPGLYAIEEGEQEKRKRSLK
LILEKKLAILERAIESNQSSVDLKLAKLKLCTEFWEPSTLVKEWQKLIFLHPNNTALWQK
YLLFCQSQFSTFSISKIHSLYGKCLSTLSAVKDGSILSHPALPGTEEAMFALFLQQCHFL
RQAGHSEKAVSLFQAMVDFTFFKPDSVKDLPTKGQVEFFEPFWDSGEPRAGEKGARGWKA
WMHQQERGGWVVINPDEDDDEPEEDDQEIKDKTLPRWQIWLAAERSRDQRHWRPWRPDKT
KKQTEEDCEDPERQVLFDDIGQSLIRLSSHNLQFQLVEAFLQFLGVPSGLTPPASCLYLA
MDENSIFDNGLYDEKPLTFFNPSFSGASCVGRMDRLGCPRWTRGQNREGEEFIRNVFHLV
MPLFSGKEKSQLCFSWLQYEIAKVIWCLHTKNKKRLKSQGKNCKKLAKNLLKEPENRNNF
CLWKQYAHLEWLLGNTEDARKVFDTALGMAGSRELKDFDLCELSLLYAELEVELSLEVRG
AATARAVHILTKLTESSPCGPYTGQVLAVHILKARKAYEHALQDCLGDSCVSDPAPADSC
SRLISLAKCFMLFQYLTTGIDAAVRIYEQVFAKLNSYVFPEGSGKGDSASSQSWTSVLEA
ITLMHTSLLRFHMKVSVYPLAPLREALSQALKLYPGNQVLWRSYVQIQNKSHSASKTRRF
FDTITRSAKALEPWLFAIEAEKLRKRLVETVQRLDGREIHATIPETGLTHRIQALFENAM
RSDSGSRCPLLWRMYLNFLVSLGNKERSKGVFYKALQNCPWAKVLYLDAVEYFPDEMQEI
LDLMTEKELRVRLPLEELELLLED
Download sequence
Identical sequences A0A096NRG6
ENSPANP00000015636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]